Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|694
Gene name
LocationContig_122:16130..17874
Strand+
Gene length (bp)1744
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain 2.3E-84 325 539
PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain 2.5E-70 157 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S3C8|NMT_NEUCR Glycylpeptide N-tetradecanoyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtt-1 PE=3 SV=2 2 540 0.0E+00
sp|Q4I061|NMT_GIBZE Glycylpeptide N-tetradecanoyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NMT1 PE=3 SV=1 60 541 0.0E+00
sp|Q9UVX3|NMT_ASPFU Glycylpeptide N-tetradecanoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nmt1 PE=1 SV=1 52 540 0.0E+00
sp|Q8TFN1|NMT_EMENI Glycylpeptide N-tetradecanoyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swoF PE=1 SV=2 62 540 0.0E+00
sp|P34763|NMT_AJECA Glycylpeptide N-tetradecanoyltransferase OS=Ajellomyces capsulatus PE=3 SV=1 5 540 3.0E-179
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S3C8|NMT_NEUCR Glycylpeptide N-tetradecanoyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtt-1 PE=3 SV=2 2 540 0.0E+00
sp|Q4I061|NMT_GIBZE Glycylpeptide N-tetradecanoyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NMT1 PE=3 SV=1 60 541 0.0E+00
sp|Q9UVX3|NMT_ASPFU Glycylpeptide N-tetradecanoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nmt1 PE=1 SV=1 52 540 0.0E+00
sp|Q8TFN1|NMT_EMENI Glycylpeptide N-tetradecanoyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swoF PE=1 SV=2 62 540 0.0E+00
sp|P34763|NMT_AJECA Glycylpeptide N-tetradecanoyltransferase OS=Ajellomyces capsulatus PE=3 SV=1 5 540 3.0E-179
sp|O43010|NMT_SCHPO Glycylpeptide N-tetradecanoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmt1 PE=1 SV=1 132 540 1.0E-146
sp|O74234|NMT_CANGA Glycylpeptide N-tetradecanoyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NMT1 PE=3 SV=2 116 540 4.0E-146
sp|P14743|NMT_YEAST Glycylpeptide N-tetradecanoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMT1 PE=1 SV=1 127 540 5.0E-142
sp|P30418|NMT_CANAL Glycylpeptide N-tetradecanoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NMT1 PE=1 SV=1 127 540 1.0E-140
sp|Q6BJF4|NMT_DEBHA Glycylpeptide N-tetradecanoyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NMT1 PE=3 SV=1 112 540 6.0E-140
sp|P34809|NMT_CRYNE Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans PE=1 SV=3 92 540 2.0E-139
sp|P0CP20|NMT_CRYNJ Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNN00080 PE=3 SV=1 92 540 6.0E-138
sp|P0CP21|NMT_CRYNB Glycylpeptide N-tetradecanoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBN0070 PE=3 SV=1 92 540 6.0E-138
sp|Q75EK2|NMT_ASHGO Glycylpeptide N-tetradecanoyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NMT1 PE=3 SV=1 127 540 8.0E-137
sp|Q6CMK4|NMT_KLULA Glycylpeptide N-tetradecanoyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMT1 PE=3 SV=1 127 540 4.0E-132
sp|Q6C7G2|NMT_YARLI Glycylpeptide N-tetradecanoyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NMT1 PE=3 SV=1 108 540 3.0E-126
sp|O61613|NMT_DROME Glycylpeptide N-tetradecanoyltransferase OS=Drosophila melanogaster GN=Nmt PE=2 SV=2 44 515 8.0E-124
sp|Q9LTR9|NMT1_ARATH Glycylpeptide N-tetradecanoyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=2 131 514 5.0E-122
sp|O60551|NMT2_HUMAN Glycylpeptide N-tetradecanoyltransferase 2 OS=Homo sapiens GN=NMT2 PE=1 SV=1 90 515 2.0E-118
sp|O70311|NMT2_MOUSE Glycylpeptide N-tetradecanoyltransferase 2 OS=Mus musculus GN=Nmt2 PE=1 SV=1 14 515 1.0E-116
sp|Q9N181|NMT2_BOVIN Glycylpeptide N-tetradecanoyltransferase 2 OS=Bos taurus GN=NMT2 PE=2 SV=1 111 515 1.0E-116
sp|A7YT82|NMT2_DANRE Glycylpeptide N-tetradecanoyltransferase 2 OS=Danio rerio GN=nmt2 PE=2 SV=2 105 515 2.0E-116
sp|Q553B6|NMT_DICDI Glycylpeptide N-tetradecanoyltransferase OS=Dictyostelium discoideum GN=nmt PE=3 SV=2 131 513 2.0E-114
sp|Q8K1Q0|NMT1_RAT Glycylpeptide N-tetradecanoyltransferase 1 OS=Rattus norvegicus GN=Nmt1 PE=1 SV=1 131 515 7.0E-114
sp|P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens GN=NMT1 PE=1 SV=2 131 515 8.0E-114
sp|O70310|NMT1_MOUSE Glycylpeptide N-tetradecanoyltransferase 1 OS=Mus musculus GN=Nmt1 PE=1 SV=1 131 515 1.0E-113
sp|Q5RAF3|NMT1_PONAB Glycylpeptide N-tetradecanoyltransferase 1 OS=Pongo abelii GN=NMT1 PE=2 SV=1 131 515 1.0E-112
sp|P31717|NMT1_BOVIN Glycylpeptide N-tetradecanoyltransferase 1 OS=Bos taurus GN=NMT1 PE=1 SV=2 131 515 6.0E-112
sp|Q4PB56|NMT_USTMA Glycylpeptide N-tetradecanoyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NMT1 PE=3 SV=1 124 525 4.0E-108
sp|Q8ILW6|NMT_PLAF7 Glycylpeptide N-tetradecanoyltransferase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0127 PE=3 SV=1 132 515 2.0E-106
sp|P46548|NMT_CAEEL Probable glycylpeptide N-tetradecanoyltransferase OS=Caenorhabditis elegans GN=nmt-1 PE=3 SV=1 131 515 3.0E-105
sp|Q94L32|NMT2_ARATH Putative glycylpeptide N-tetradecanoyltransferase 2 OS=Arabidopsis thaliana GN=NMT2 PE=5 SV=1 131 514 1.0E-82
sp|Q5UR64|NMT_MIMIV Putative glycylpeptide N-tetradecanoyltransferase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L621 PE=3 SV=1 150 448 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004379 glycylpeptide N-tetradecanoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0019107 myristoyltransferase activity No
GO:0016410 N-acyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|694
MPTEESKPVQPAAEEAPTETPEPGGDSGPDEPRGGKAAGKKSKRAKAKELLKRKSGGDHEADIKQAMSGLTHQQT
KELLALNPGLAQQLSQASGSAEPTPEQAVDMLRKMKLQDIMTGLASGGKNVKDMGAYKFWQTQPVPRFGDDDSVQ
EGPLSVKTVDEVPKQPKPLPDGFEWVTLDLESDDQMKELFELLNKHYVEDDEAMFRFNYSPAILRWAMMAPGWHR
RYHVGVRASQSRKLVAFISAIPVRLRVRTKTVLCSEVNFLCIHKKLRGLRLAPVLIREITRVSNENEVWQGVYTA
GVVLPTPVSTCRYFHRALNWQKLHDCGFSPLPPGSKPQYQVRKYALPDETTTRGLRAMKAEDVDAVIGLLERYLA
RFDMAPEFTREEALHWFIPKAEAEQVIWSYVVEDKDKKMTDFFSFFCVESSVINNSKHDVIRVAYMFYYASEAGL
TQPPDRPALKTRLNSLVNDALILAKRAKLDVFNALTLMDNTLFLEQQKFGAGDGQLHYYLFNYRANHIAGGIDKR
NQMDEDGGSGIGLVMP*
Coding >Ophun1|694
ATGCCCACGGAAGAGTCCAAGCCCGTCCAGCCGGCGGCCGAAGAGGCCCCGACCGAAACACCGGAGCCCGGAGGC
GACTCGGGACCGGACGAGCCCCGCGGCGGCAAGGCAGCGGGCAAGAAGTCCAAGAGGGCCAAGGCAAAAGAGCTC
CTCAAGCGCAAGTCCGGCGGCGACCATGAAGCCGACATCAAGCAGGCAATGAGCGGACTCACGCATCAGCAGACC
AAGGAGCTGCTGGCGCTGAACCCGGGCCTGGCGCAACAGCTGTCGCAGGCATCGGGGAGTGCGGAGCCGACGCCT
GAGCAGGCCGTCGATATGCTGCGCAAGATGAAGCTGCAGGACATCATGACGGGGCTGGCTTCGGGTGGCAAGAAC
GTCAAGGATATGGGCGCCTACAAGTTCTGGCAGACGCAGCCCGTGCCGCGCTTCGGCGATGACGACTCTGTGCAG
GAGGGCCCGCTGAGTGTCAAGACGGTCGACGAGGTGCCCAAGCAGCCGAAGCCGCTTCCGGACGGGTTCGAGTGG
GTGACGCTGGATCTCGAGAGTGACGACCAGATGAAGGAGCTGTTTGAGCTGCTCAACAAGCATTACGTCGAGGAC
GATGAGGCCATGTTCCGCTTCAACTACTCGCCGGCCATTCTACGGTGGGCCATGATGGCGCCCGGCTGGCACAGA
CGCTACCACGTGGGCGTACGAGCATCCCAATCTCGCAAGCTCGTCGCCTTCATCTCCGCCATCCCCGTCCGACTC
CGCGTGCGAACCAAGACGGTACTCTGCTCAGAGGTCAACTTCCTCTGCATACACAAGAAACTACGCGGCCTGCGG
CTCGCTCCCGTCCTCATCCGCGAGATCACACGCGTCAGCAACGAGAACGAGGTCTGGCAGGGCGTCTACACTGCA
GGCGTCGTGCTGCCAACGCCCGTCAGCACGTGCCGCTACTTCCACCGCGCCCTCAACTGGCAGAAGCTGCACGAC
TGCGGCTTCAGCCCCTTGCCGCCGGGCAGCAAGCCGCAGTATCAGGTGCGCAAGTATGCGCTGCCCGACGAGACG
ACGACGCGCGGGCTGCGTGCCATGAAGGCCGAAGACGTCGATGCCGTCATTGGCTTGCTCGAGAGGTATCTCGCC
CGCTTCGATATGGCGCCAGAGTTTACGCGAGAAGAGGCTCTGCATTGGTTCATACCCAAGGCCGAGGCGGAGCAG
GTCATCTGGTCGTACGTAGTCGAGGACAAGGACAAGAAAATGACCGACTTCTTCTCCTTCTTCTGCGTCGAGTCG
TCCGTCATCAACAACTCCAAGCACGACGTAATCCGCGTCGCCTACATGTTCTACTACGCCTCAGAAGCGGGCCTC
ACCCAGCCCCCCGACCGACCAGCCCTCAAGACCCGACTCAACAGCCTCGTCAACGACGCCCTCATCCTAGCCAAG
CGCGCCAAGCTCGACGTCTTCAACGCGCTGACCCTCATGGATAACACGCTCTTCCTCGAGCAGCAAAAGTTTGGC
GCCGGCGACGGCCAGCTGCATTACTATCTTTTCAATTACCGGGCCAACCACATCGCCGGCGGCATCGATAAGAGG
AATCAGATGGATGAGGATGGGGGTAGCGGGATTGGGCTGGTTATGCCTTGA
Transcript >Ophun1|694
ATGCCCACGGAAGAGTCCAAGCCCGTCCAGCCGGCGGCCGAAGAGGCCCCGACCGAAACACCGGAGCCCGGAGGC
GACTCGGGACCGGACGAGCCCCGCGGCGGCAAGGCAGCGGGCAAGAAGTCCAAGAGGGCCAAGGCAAAAGAGCTC
CTCAAGCGCAAGTCCGGCGGCGACCATGAAGCCGACATCAAGCAGGCAATGAGCGGACTCACGCATCAGCAGACC
AAGGAGCTGCTGGCGCTGAACCCGGGCCTGGCGCAACAGCTGTCGCAGGCATCGGGGAGTGCGGAGCCGACGCCT
GAGCAGGCCGTCGATATGCTGCGCAAGATGAAGCTGCAGGACATCATGACGGGGCTGGCTTCGGGTGGCAAGAAC
GTCAAGGATATGGGCGCCTACAAGTTCTGGCAGACGCAGCCCGTGCCGCGCTTCGGCGATGACGACTCTGTGCAG
GAGGGCCCGCTGAGTGTCAAGACGGTCGACGAGGTGCCCAAGCAGCCGAAGCCGCTTCCGGACGGGTTCGAGTGG
GTGACGCTGGATCTCGAGAGTGACGACCAGATGAAGGAGCTGTTTGAGCTGCTCAACAAGCATTACGTCGAGGAC
GATGAGGCCATGTTCCGCTTCAACTACTCGCCGGCCATTCTACGGTGGGCCATGATGGCGCCCGGCTGGCACAGA
CGCTACCACGTGGGCGTACGAGCATCCCAATCTCGCAAGCTCGTCGCCTTCATCTCCGCCATCCCCGTCCGACTC
CGCGTGCGAACCAAGACGGTACTCTGCTCAGAGGTCAACTTCCTCTGCATACACAAGAAACTACGCGGCCTGCGG
CTCGCTCCCGTCCTCATCCGCGAGATCACACGCGTCAGCAACGAGAACGAGGTCTGGCAGGGCGTCTACACTGCA
GGCGTCGTGCTGCCAACGCCCGTCAGCACGTGCCGCTACTTCCACCGCGCCCTCAACTGGCAGAAGCTGCACGAC
TGCGGCTTCAGCCCCTTGCCGCCGGGCAGCAAGCCGCAGTATCAGGTGCGCAAGTATGCGCTGCCCGACGAGACG
ACGACGCGCGGGCTGCGTGCCATGAAGGCCGAAGACGTCGATGCCGTCATTGGCTTGCTCGAGAGGTATCTCGCC
CGCTTCGATATGGCGCCAGAGTTTACGCGAGAAGAGGCTCTGCATTGGTTCATACCCAAGGCCGAGGCGGAGCAG
GTCATCTGGTCGTACGTAGTCGAGGACAAGGACAAGAAAATGACCGACTTCTTCTCCTTCTTCTGCGTCGAGTCG
TCCGTCATCAACAACTCCAAGCACGACGTAATCCGCGTCGCCTACATGTTCTACTACGCCTCAGAAGCGGGCCTC
ACCCAGCCCCCCGACCGACCAGCCCTCAAGACCCGACTCAACAGCCTCGTCAACGACGCCCTCATCCTAGCCAAG
CGCGCCAAGCTCGACGTCTTCAACGCGCTGACCCTCATGGATAACACGCTCTTCCTCGAGCAGCAAAAGTTTGGC
GCCGGCGACGGCCAGCTGCATTACTATCTTTTCAATTACCGGGCCAACCACATCGCCGGCGGCATCGATAAGAGG
AATCAGATGGATGAGGATGGGGGTAGCGGGATTGGGCTGGTTATGCCTTGA
Gene >Ophun1|694
ATGCCCACGGAAGAGTCCAAGCCCGTCCAGCCGGCGGCCGAAGAGGCCCCGACCGAAACACCGGAGCCCGGAGGC
GACTCGGGACCGGACGAGCCCCGCGGCGGCAAGGCAGCGGGCAAGAAGTCCAAGAGGGCCAAGGCAAAAGAGCTC
CTCAAGCGCAAGTCCGGCGGCGACCATGAAGCCGACATCAAGCAGGCAATGAGCGGACTCACGCATCAGCAGACC
AAGGAGCTGCTGGCGCTGAACCCGGGCCTGGCGCAACAGCTGTCGCAGGCATCGGGGAGTGCGGAGCCGACGCCT
GAGCAGGCCGTCGATATGCTGCGCAAGATGAAGCTGCAGGACATCATGACGGGGCTGGCTTCGGGTGGCAAGAAC
GTCAAGGATATGGGCGCCTACAAGTTCTGGCAGACGCAGCCCGTGCCGCGCTTCGGCGATGACGACTCTGTGCAG
GAGGGCCCGCTGAGTGTCAAGACGGTCGACGAGGTGCCCAAGCAGCCGAAGCCGCTTCCGGACGGGTTCGAGTGG
GTGACGCTGGATCTCGAGAGTGACGACCAGATGAAGGAGCTGTTTGAGCTGCTCAACAAGCATTACGTCGAGGAC
GATGAGGCCATGTTCCGCTTCAACTACTCGCCGGCCATTCTACGGTGGTAAGTGAACAGACACTTCCGTGCAAAC
GAGAGAAAAGATGAGACGTCTGACCTCGCATTTCAGGGCCATGATGGCGCCCGGCTGGCACAGACGCTACCACGT
GGGCGTACGAGCATCCCAATCTCGCAAGCTCGTCGCCTTCATCTCCGCCATCCCCGTCCGACTCCGCGTGCGAAC
CAAGACGGTACTCTGCTCAGAGGTCAACTTCCTCTGCATACACAAGAAACTACGCGGCCTGCGGCTCGCTCCCGT
CCTCATCCGCGAGATCACACGCGTCAGCAACGAGAACGAGGTCTGGCAGGGCGTCTACACTGCAGGCGTCGTGCT
GCCAACGCCCGTCAGCACGTGCCGCTACTTCCACCGCGCCCTCAACTGGCAGAAGCTGCACGACTGCGGCTTCAG
CCCCTTGCCGCCGGGCAGCAAGCCGCAGTATCAGGTGCGCAAGTATGCGCTGCCCGACGAGACGACGACGCGCGG
GCTGCGTGCCATGAAGGCCGAAGACGTCGATGCCGTCATTGGCTTGCTCGAGAGGTATCTCGCCCGCTTCGATAT
GGCGCCAGAGTTTACGCGAGAAGAGGCTCTGCATTGGTTCATACCCAAGGCCGAGGCGGAGCAGGTCATCTGGTC
GTACGTAGTCGAGGTAAGAATATCTCCCAAACAAGAAGACGAGATTAAAGGCTCACCCTCCTCAAAGGACAAGGA
CAAGAAAATGACCGACTTCTTCTCCTTCTTCTGCGTCGAGTCGTCCGTCATCAACAACTCCAAGCACGACGTAAT
CCGCGTCGCCTACATGTTCTACTACGCCTCAGAAGCGGGCCTCACCCAGCCCCCCGACCGACCAGCCCTCAAGAC
CCGACTCAACAGCCTCGTCAACGACGCCCTCATCCTAGCCAAGCGCGCCAAGCTCGACGTCTTCAACGCGCTGAC
CCTCATGGATAACACGCTCTTCCTCGAGCAGCAAAAGTTTGGCGCCGGCGACGGCCAGCTGCATTACTATCTTTT
CAATTACCGGGCCAACCACATCGCCGGCGGCATCGATAAGAGGAATCAGATGGATGAGGATGGGGGTAGCGGGAT
TGGGCTGGTTATGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail