Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6934
Gene name
LocationContig_800:931..3693
Strand+
Gene length (bp)2762
Transcript length (bp)2646
Coding sequence length (bp)2646
Protein length (aa) 882

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04468 PSP1 PSP1 C-terminal conserved region 2.4E-28 619 702

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V4|YOM2_SCHPO Uncharacterized protein PB7E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB7E8.02 PE=3 SV=1 500 710 1.0E-34
sp|P50896|PSP1_YEAST Protein PSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSP1 PE=1 SV=2 500 702 3.0E-17
sp|Q06251|YL177_YEAST Uncharacterized protein YLR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR177W PE=1 SV=1 496 702 6.0E-17
sp|P37541|YAAT_BACSU Stage 0 sporulation protein YaaT OS=Bacillus subtilis (strain 168) GN=yaaT PE=3 SV=1 621 722 1.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2448
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7824
Ophiocordyceps australis map64 (Brazil) OphauB2|6479
Ophiocordyceps camponoti-floridani Ophcf2|06590
Ophiocordyceps camponoti-rufipedis Ophun1|6934 (this protein)
Ophiocordyceps kimflemingae Ophio5|4211
Ophiocordyceps subramaniannii Hirsu2|350

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6934
MSSVSLKTGRSSKLVQGPVGAQNSQSILLDKVGARTSTPDSEALASSEDEGEHRPDLPQTSTVQLPMPARRSSWL
NDTSQTISRPRKGSFASSSMSPTASHPNTPSAEAGNGSWANSSVMGRAAASSTFTWGTGIWNDRKDVHSRLSEHL
PSPTSTIPPGAGSNSFFGPDVGMKQTSPATREPGPTSQIPFAIPLHPTPKTYRSQSYSVGQLDPENAPPPTMSSS
TVMGRARHPALQHRPSRPSLLSEMANDGSVLDKVKEDDGDDDEGAAEVLQNSYQMSESKTIEMLARENAMLRQHQ
HYNSRLRPRASTGAYLANGYPLREVVPEESDFAIDELDEANEAGDPFGRRAAGRRMSEYGGGPGRALGLDSRKLD
NMNLKKALWSSSPGFFGGDVSQSRRHSFANMPTRQGSISSIADSVSTLDANADGQTPQGFSIFGDNQGFSTSAGN
PLFGGGSNSLQAAFGASYASFGLQDQYANRAPSPHRNVYGMPQPRHNQLLHMVLFKCARADVFYIQEGTGLTVKP
GDLVIVEADRGTDLGTVARDNVDWQTAKDLKEHYAEEHYKWLMMYSQGAAAAQDGAGPVLHNSGFHGSAIGGMGP
PSQHHLQEPNAGDLRPKLIKRLAQNHEIQSLRDKEGQEAKAKRVCMQKVKEHGLNMEILDAEFQMDWKKLTFYYF
ADSYINFNSLVTDLFKIYKTRIWMSAINPASFASPTLGIQAPSGIGPGAVGVGRGTSGAERRQTQQAQEQQQQQQ
QQQQQQQQQQQAYSQTPPQRGFRSPFAQPFGGDRQMPTATGYSSSNYAYGPGGVFGNARGAASYVPGLAAGLDGL
SHGGYHQPPEFQSMRQRLQATQGMSGAGPHSQSVVSPLVGQNDWAAAFQGLSLNTH*
Coding >Ophun1|6934
ATGAGCTCCGTTTCCCTCAAGACAGGGCGTTCGTCGAAGCTGGTCCAGGGGCCCGTCGGGGCCCAAAACAGCCAG
AGCATCCTCTTGGACAAGGTCGGCGCCCGAACCTCGACTCCCGACTCCGAGGCGCTGGCCAGTTCCGAAGACGAA
GGCGAACATCGTCCAGACTTGCCACAAACATCAACAGTCCAGCTCCCAATGCCTGCCCGTCGATCCTCGTGGCTC
AACGACACGTCGCAGACCATCTCGCGACCTCGCAAGGGCTCCTTTGCGAGCAGCTCCATGTCTCCCACCGCATCT
CACCCCAATACGCCGTCGGCAGAGGCCGGGAATGGGTCTTGGGCCAACTCGTCCGTCATGGGTCGCGCCGCCGCT
TCCTCCACCTTCACCTGGGGAACCGGCATATGGAACGACCGTAAAGACGTGCACTCGCGCCTCAGCGAACACCTG
CCGTCGCCCACCTCGACCATACCGCCCGGAGCCGGCTCCAACTCTTTCTTCGGACCCGACGTCGGCATGAAGCAG
ACTTCTCCGGCCACGCGTGAGCCGGGTCCGACTTCGCAGATCCCCTTCGCCATCCCTCTGCATCCCACCCCCAAG
ACGTACCGATCTCAATCATATTCTGTCGGGCAGCTGGATCCCGAGAACGCGCCGCCGCCGACGATGAGCTCGTCG
ACCGTCATGGGCCGCGCACGCCACCCTGCGCTGCAGCATCGGCCTTCTCGCCCCAGTTTGCTGAGCGAGATGGCC
AACGACGGATCCGTCCTCGACAAGGTCAAGGAAGACGATGGCGACGATGATGAGGGCGCAGCAGAGGTCCTCCAG
AACTCGTATCAGATGTCCGAATCGAAGACGATCGAGATGCTCGCGCGCGAAAACGCCATGCTGCGGCAGCACCAG
CACTACAACAGTCGCCTTCGGCCTCGCGCCTCCACCGGGGCCTACTTGGCAAACGGCTACCCGCTGCGGGAAGTC
GTTCCGGAAGAGTCTGATTTTGCCATTGACGAGCTGGACGAGGCCAACGAGGCCGGGGATCCTTTCGGGAGGCGC
GCCGCTGGTAGGCGCATGAGCGAGTACGGTGGCGGTCCCGGTCGCGCTCTCGGCTTGGACAGTCGAAAACTGGAT
AACATGAACCTCAAAAAGGCCCTCTGGTCGAGCTCGCCCGGCTTCTTCGGAGGAGACGTGTCGCAAAGCAGGCGT
CATTCGTTCGCCAACATGCCCACTCGTCAGGGATCCATCAGCTCCATCGCCGACTCGGTATCGACCCTGGATGCC
AACGCCGATGGCCAGACGCCGCAGGGCTTTTCCATCTTTGGTGACAACCAGGGCTTCTCGACCTCTGCCGGCAAC
CCTCTTTTCGGCGGCGGATCCAACTCGCTCCAAGCCGCCTTTGGCGCGTCTTACGCTTCGTTTGGATTACAGGAC
CAGTACGCCAACAGGGCGCCGTCTCCTCACCGCAACGTTTACGGCATGCCTCAGCCGAGACACAACCAGCTACTG
CACATGGTCCTCTTCAAGTGTGCCAGGGCCGACGTCTTCTACATTCAGGAGGGTACCGGCTTGACTGTCAAGCCG
GGCGATTTGGTCATTGTCGAAGCTGATCGCGGCACTGACCTCGGCACCGTGGCCAGGGACAATGTCGACTGGCAG
ACCGCCAAGGACTTGAAGGAGCACTACGCCGAAGAGCACTACAAGTGGCTCATGATGTATTCGCAGGGCGCCGCG
GCAGCACAGGACGGCGCCGGCCCTGTCCTCCACAACTCTGGATTTCACGGGAGCGCCATAGGCGGCATGGGGCCC
CCGAGCCAGCACCACCTGCAGGAACCCAACGCGGGAGACCTTCGGCCGAAGCTGATCAAGCGCCTCGCCCAGAAC
CACGAGATTCAGTCCTTGCGGGACAAGGAGGGACAGGAGGCAAAGGCGAAACGGGTCTGCATGCAAAAGGTCAAG
GAGCATGGCTTGAACATGGAGATCCTCGATGCCGAGTTTCAGATGGACTGGAAAAAGCTCACCTTTTACTATTTC
GCCGATTCCTACATCAACTTCAATTCCCTCGTCACGGACCTGTTCAAGATCTACAAGACTAGAATCTGGATGTCA
GCCATAAACCCTGCGTCCTTTGCGAGTCCCACTCTGGGCATCCAGGCCCCGAGCGGCATCGGTCCCGGCGCGGTC
GGAGTCGGACGTGGCACGAGCGGGGCCGAACGCCGGCAGACGCAACAGGCTCAGGAGCAGCAGCAGCAGCAGCAG
CAGCAACAACAGCAGCAGCAGCAGCAGCAACAGGCTTATTCTCAGACACCACCACAGCGTGGATTCCGCTCTCCA
TTTGCTCAGCCATTCGGAGGGGACCGGCAGATGCCGACGGCGACCGGATACTCGTCATCCAACTACGCCTACGGA
CCTGGGGGCGTGTTTGGAAACGCCAGAGGCGCCGCCTCGTACGTCCCCGGCCTCGCCGCGGGCCTCGACGGGCTC
TCGCACGGCGGATACCATCAACCCCCGGAGTTCCAGTCGATGCGGCAGCGCTTGCAGGCAACCCAAGGCATGTCG
GGCGCAGGGCCACACTCGCAGAGCGTCGTGTCACCTCTCGTGGGACAGAACGATTGGGCAGCTGCTTTCCAGGGC
CTATCTCTCAACACGCATTAA
Transcript >Ophun1|6934
ATGAGCTCCGTTTCCCTCAAGACAGGGCGTTCGTCGAAGCTGGTCCAGGGGCCCGTCGGGGCCCAAAACAGCCAG
AGCATCCTCTTGGACAAGGTCGGCGCCCGAACCTCGACTCCCGACTCCGAGGCGCTGGCCAGTTCCGAAGACGAA
GGCGAACATCGTCCAGACTTGCCACAAACATCAACAGTCCAGCTCCCAATGCCTGCCCGTCGATCCTCGTGGCTC
AACGACACGTCGCAGACCATCTCGCGACCTCGCAAGGGCTCCTTTGCGAGCAGCTCCATGTCTCCCACCGCATCT
CACCCCAATACGCCGTCGGCAGAGGCCGGGAATGGGTCTTGGGCCAACTCGTCCGTCATGGGTCGCGCCGCCGCT
TCCTCCACCTTCACCTGGGGAACCGGCATATGGAACGACCGTAAAGACGTGCACTCGCGCCTCAGCGAACACCTG
CCGTCGCCCACCTCGACCATACCGCCCGGAGCCGGCTCCAACTCTTTCTTCGGACCCGACGTCGGCATGAAGCAG
ACTTCTCCGGCCACGCGTGAGCCGGGTCCGACTTCGCAGATCCCCTTCGCCATCCCTCTGCATCCCACCCCCAAG
ACGTACCGATCTCAATCATATTCTGTCGGGCAGCTGGATCCCGAGAACGCGCCGCCGCCGACGATGAGCTCGTCG
ACCGTCATGGGCCGCGCACGCCACCCTGCGCTGCAGCATCGGCCTTCTCGCCCCAGTTTGCTGAGCGAGATGGCC
AACGACGGATCCGTCCTCGACAAGGTCAAGGAAGACGATGGCGACGATGATGAGGGCGCAGCAGAGGTCCTCCAG
AACTCGTATCAGATGTCCGAATCGAAGACGATCGAGATGCTCGCGCGCGAAAACGCCATGCTGCGGCAGCACCAG
CACTACAACAGTCGCCTTCGGCCTCGCGCCTCCACCGGGGCCTACTTGGCAAACGGCTACCCGCTGCGGGAAGTC
GTTCCGGAAGAGTCTGATTTTGCCATTGACGAGCTGGACGAGGCCAACGAGGCCGGGGATCCTTTCGGGAGGCGC
GCCGCTGGTAGGCGCATGAGCGAGTACGGTGGCGGTCCCGGTCGCGCTCTCGGCTTGGACAGTCGAAAACTGGAT
AACATGAACCTCAAAAAGGCCCTCTGGTCGAGCTCGCCCGGCTTCTTCGGAGGAGACGTGTCGCAAAGCAGGCGT
CATTCGTTCGCCAACATGCCCACTCGTCAGGGATCCATCAGCTCCATCGCCGACTCGGTATCGACCCTGGATGCC
AACGCCGATGGCCAGACGCCGCAGGGCTTTTCCATCTTTGGTGACAACCAGGGCTTCTCGACCTCTGCCGGCAAC
CCTCTTTTCGGCGGCGGATCCAACTCGCTCCAAGCCGCCTTTGGCGCGTCTTACGCTTCGTTTGGATTACAGGAC
CAGTACGCCAACAGGGCGCCGTCTCCTCACCGCAACGTTTACGGCATGCCTCAGCCGAGACACAACCAGCTACTG
CACATGGTCCTCTTCAAGTGTGCCAGGGCCGACGTCTTCTACATTCAGGAGGGTACCGGCTTGACTGTCAAGCCG
GGCGATTTGGTCATTGTCGAAGCTGATCGCGGCACTGACCTCGGCACCGTGGCCAGGGACAATGTCGACTGGCAG
ACCGCCAAGGACTTGAAGGAGCACTACGCCGAAGAGCACTACAAGTGGCTCATGATGTATTCGCAGGGCGCCGCG
GCAGCACAGGACGGCGCCGGCCCTGTCCTCCACAACTCTGGATTTCACGGGAGCGCCATAGGCGGCATGGGGCCC
CCGAGCCAGCACCACCTGCAGGAACCCAACGCGGGAGACCTTCGGCCGAAGCTGATCAAGCGCCTCGCCCAGAAC
CACGAGATTCAGTCCTTGCGGGACAAGGAGGGACAGGAGGCAAAGGCGAAACGGGTCTGCATGCAAAAGGTCAAG
GAGCATGGCTTGAACATGGAGATCCTCGATGCCGAGTTTCAGATGGACTGGAAAAAGCTCACCTTTTACTATTTC
GCCGATTCCTACATCAACTTCAATTCCCTCGTCACGGACCTGTTCAAGATCTACAAGACTAGAATCTGGATGTCA
GCCATAAACCCTGCGTCCTTTGCGAGTCCCACTCTGGGCATCCAGGCCCCGAGCGGCATCGGTCCCGGCGCGGTC
GGAGTCGGACGTGGCACGAGCGGGGCCGAACGCCGGCAGACGCAACAGGCTCAGGAGCAGCAGCAGCAGCAGCAG
CAGCAACAACAGCAGCAGCAGCAGCAGCAACAGGCTTATTCTCAGACACCACCACAGCGTGGATTCCGCTCTCCA
TTTGCTCAGCCATTCGGAGGGGACCGGCAGATGCCGACGGCGACCGGATACTCGTCATCCAACTACGCCTACGGA
CCTGGGGGCGTGTTTGGAAACGCCAGAGGCGCCGCCTCGTACGTCCCCGGCCTCGCCGCGGGCCTCGACGGGCTC
TCGCACGGCGGATACCATCAACCCCCGGAGTTCCAGTCGATGCGGCAGCGCTTGCAGGCAACCCAAGGCATGTCG
GGCGCAGGGCCACACTCGCAGAGCGTCGTGTCACCTCTCGTGGGACAGAACGATTGGGCAGCTGCTTTCCAGGGC
CTATCTCTCAACACGCATTAA
Gene >Ophun1|6934
ATGAGCTCCGTTTCCCTCAAGACAGGGCGTTCGTCGAAGCTGGTCCAGGGGCCCGTCGGGGCCCAAAACAGCCAG
AGCATCCTCTTGGACAAGGTCGGCGCCCGAACCTCGACTCCCGACTCCGAGGCGCTGGCCAGTTCCGAAGACGAA
GGCGAACATCGTCCAGACTTGCCACAAACATCAACAGTCCAGCTCCCAATGCCTGCCCGTCGATCCTCGTGGCTC
AACGACACGTCGCAGACCATCTCGCGACCTCGCAAGGGCTCCTTTGCGAGCAGCTCCATGTCTCCCACCGCATCT
CACCCCAATACGCCGTCGGCAGAGGCCGGGAATGGGTCTTGGGCCAACTCGTCCGTCATGGGTCGCGCCGCCGCT
TCCTCCACCTTCACCTGGGGAACCGGCATATGGAACGACCGTAAAGACGTGCACTCGCGCCTCAGCGAACACCTG
CCGTCGCCCACCTCGACCATACCGCCCGGAGCCGGCTCCAACTCTTTCTTCGGACCCGACGTCGGCATGAAGCAG
ACTTCTCCGGCCACGCGTGAGCCGGGTCCGACTTCGCAGATCCCCTTCGCCATCCCTCTGCATCCCACCCCCAAG
ACGTACCGATCTCAATCATATTCTGTCGGGCAGCTGGATCCCGAGAACGCGCCGCCGCCGACGATGAGCTCGTCG
ACCGTCATGGGCCGCGCACGCCACCCTGCGCTGCAGCATCGGCCTTCTCGCCCCAGTTTGCTGAGCGAGATGGCC
AACGACGGATCCGTCCTCGACAAGGTCAAGGAAGACGATGGCGACGATGATGAGGGCGCAGCAGAGGTCCTCCAG
AACTCGTATCAGATGTCCGAATCGAAGACGATCGAGATGCTCGCGCGCGAAAACGCCATGCTGCGGCAGCACCAG
CACTACAACAGTCGCCTTCGGCCTCGCGCCTCCACCGGGGCCTACTTGGCAAACGGCTACCCGCTGCGGGAAGTC
GTTCCGGAAGAGTCTGATTTTGCCATTGACGAGCTGGACGAGGCCAACGAGGCCGGGGATCCTTTCGGGAGGCGC
GCCGCTGGTAGGCGCATGAGCGAGTACGGTGGCGGTCCCGGTCGCGCTCTCGGCTTGGACAGTCGAAAACTGGAT
AACATGAACCTCAAAAAGGCCCTCTGGTCGAGCTCGCCCGGCTTCTTCGGAGGAGACGTGTCGCAAAGCAGGCGT
CATTCGTTCGCCAACATGCCCACTCGTCAGGGATCCATCAGCTCCATCGCCGACTCGGTATCGACCCTGGATGCC
AACGCCGATGGCCAGACGCCGCAGGGCTTTTCCATCTTTGGTGACAACCAGGGCTTCTCGACCTCTGCCGGCAAC
CGTGAGTTCCCTCTGTCCTCTACACCTTGTCTGAACGAGTCTGTGGCTGACCCGCTTCGGCGCAAAGCAGCTCTT
TTCGGCGGCGGATCCAACTCGCTCCAAGCCGCCTTTGGCGCGTCTTACGCTTCGTTTGGATTACAGGACCAGTAC
GCCAACAGGGCGCCGTCTCCTCACCGCAACGTTTACGGCATGCCTCAGCCGAGACACAACCAGCTACTGCACATG
GTCCTCTTCAAGTGTGCCAGGGCCGACGTCTTCTACATTCAGGAGGGTACCGGCTTGACTGTCAAGCCGGGCGAT
TTGGTCATTGTCGAAGCTGATCGCGGCACTGACCTCGGCACCGTGGCCAGGGACAATGTCGACTGGCAGACCGCC
AAGGACTTGAAGGAGCACTACGCCGAAGAGCACTACAAGTGGCTCATGATGTATTCGCAGGGCGCCGCGGCAGCA
CAGGACGGCGCCGGCCCTGTCCTCCACAACTCTGGATTTCACGGGAGCGCCATAGGCGGCATGGGGCCCCCGAGC
CAGCACCACCTGCAGGAACCCAACGCGGGAGACCTTCGGCCGAAGCTGATCAAGCGCCTCGCCCAGAACCACGAG
ATTCAGTCCTTGCGGGACAAGGAGGGACAGGAGGCAAAGGCGAAACGGGTCTGCATGCAAAAGGTCAAGGAGCAT
GGCTTGAACATGGAGATCCTCGATGCCGAGTTTCAGATGTAAGCCTTCCCTCTCCTCCCTCTGAACCATACTGAC
GAGCGTACAGGGACTGGAAAAAGCTCACCTTTTACTATTTCGCCGATTCCTACATCAACTTCAATTCCCTCGTCA
CGGACCTGTTCAAGATCTACAAGACTAGAATCTGGATGTCAGCCATAAACCCTGCGTCCTTTGCGAGTCCCACTC
TGGGCATCCAGGCCCCGAGCGGCATCGGTCCCGGCGCGGTCGGAGTCGGACGTGGCACGAGCGGGGCCGAACGCC
GGCAGACGCAACAGGCTCAGGAGCAGCAGCAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGCAACAGG
CTTATTCTCAGACACCACCACAGCGTGGATTCCGCTCTCCATTTGCTCAGCCATTCGGAGGGGACCGGCAGATGC
CGACGGCGACCGGATACTCGTCATCCAACTACGCCTACGGACCTGGGGGCGTGTTTGGAAACGCCAGAGGCGCCG
CCTCGTACGTCCCCGGCCTCGCCGCGGGCCTCGACGGGCTCTCGCACGGCGGATACCATCAACCCCCGGAGTTCC
AGTCGATGCGGCAGCGCTTGCAGGCAACCCAAGGCATGTCGGGCGCAGGGCCACACTCGCAGAGCGTCGTGTCAC
CTCTCGTGGGACAGAACGATTGGGCAGCTGCTTTCCAGGGCCTATCTCTCAACACGCATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail