Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6929
Gene name
LocationContig_80:31206..32928
Strand+
Gene length (bp)1722
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-40 50 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 8 487 5.0E-126
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 10 481 5.0E-115
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 8 481 2.0E-70
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 41 481 1.0E-66
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 84 478 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 8 487 5.0E-126
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 10 481 5.0E-115
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 8 481 2.0E-70
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 41 481 1.0E-66
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 84 478 2.0E-13
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 49 373 5.0E-12
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 80 386 3.0E-11
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 80 386 3.0E-11
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 78 370 9.0E-10
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 78 370 9.0E-10
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 16 406 1.0E-09
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 79 463 6.0E-08
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 79 463 8.0E-08
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 79 463 8.0E-08
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 79 463 8.0E-08
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 79 463 2.0E-07
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 81 481 4.0E-07
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 70 478 1.0E-06
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 65 479 1.0E-06
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 60 380 2.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 80 206 8.0E-06
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 60 380 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 80 102 22
3 117 139 22
4 146 163 17
5 173 195 22
6 202 224 22
7 257 279 22
8 286 308 22
9 328 350 22
10 363 385 22
11 395 417 22
12 424 446 22
13 456 478 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6929
MLQDGGPDATSSKKNMSDSNGEEPGIEGTRAWASQGMTPWREALLVFTACMAQFCTQTAFFSTLILLRPIGASFG
IDSPARLAWLVAAFSLAAGTLIIFCGRLGDVFGHGRMLILGFTWWAVWSAISGLSVYSTFYLSVISRAMQGVGPA
VTLPNALAVLGTAYPPGHRKAMVFAMFGAVAPVGAVVGGVFASLLAEVWWPWAMWVFAAWLLVLAVLAGFAVPLR
DERDDDDDDGGGGEKGVASSSSSAERGFKDTLLALDVPAAVIGIMALVLFSFAWTQAPVDGWSAPSVLVPLVAGL
VLFALFLYTETKLSPSPLVPFQALTTDVAFVLAAVLCGWASFGVWTLYVVLTLQEARGLSPLMLTAYFCPVAFSG
AAAAVVTGLMLGPLRLGPPTVMTVALAAFTIGSVLTAVAPVHQTYWAQLFVAFLVMPVGMDCSFPASTLIVSNAV
ARRHQGVGASLVSTVVNYGIALGVGFAGTAEMMELDGCEGI*
Coding >Ophun1|6929
ATGCTGCAAGATGGCGGCCCGGATGCCACGTCGTCCAAGAAGAACATGTCGGATTCCAACGGAGAGGAGCCTGGC
ATCGAGGGGACGAGGGCTTGGGCTTCGCAGGGGATGACGCCTTGGAGGGAGGCTTTGCTGGTGTTTACGGCTTGC
ATGGCGCAGTTTTGCACGCAGACGGCTTTCTTCTCTACCCTCATCCTGCTGCGTCCCATCGGCGCCTCGTTCGGT
ATCGACAGTCCGGCGAGATTGGCCTGGCTGGTGGCCGCCTTCTCCCTCGCAGCCGGAACCCTCATCATCTTCTGC
GGCCGTCTGGGCGACGTCTTTGGCCACGGTCGGATGCTCATCCTGGGCTTCACCTGGTGGGCGGTCTGGTCGGCC
ATCTCAGGCCTCTCCGTCTACTCAACCTTCTACCTGTCCGTCATCTCGCGCGCCATGCAAGGCGTAGGCCCCGCC
GTGACGCTCCCCAACGCGCTGGCGGTGCTGGGAACGGCCTACCCGCCCGGCCACCGCAAAGCAATGGTCTTCGCC
ATGTTCGGGGCTGTGGCGCCGGTTGGGGCTGTTGTCGGGGGCGTCTTTGCTAGTTTGCTGGCTGAGGTTTGGTGG
CCTTGGGCTATGTGGGTTTTTGCGGCTTGGTTGCTTGTTTTGGCGGTTTTGGCGGGCTTTGCTGTGCCGTTGAGG
GATGAGCGGGATGATGATGATGATGATGGTGGTGGTGGTGAGAAGGGGGTTGCTTCTTCTTCTTCTTCTGCGGAG
CGGGGGTTTAAGGATACTTTGCTCGCACTCGACGTGCCAGCCGCCGTCATCGGAATCATGGCTCTCGTTCTCTTT
AGCTTCGCCTGGACACAAGCCCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCCCTCGTGGCAGGCCTC
GTCCTCTTCGCCCTCTTCCTCTACACGGAGACGAAGCTGAGTCCCTCACCGCTGGTCCCCTTCCAGGCCCTTACA
ACAGACGTGGCCTTTGTGCTAGCCGCCGTGCTGTGCGGCTGGGCGAGTTTCGGCGTGTGGACGCTCTACGTGGTG
TTGACGCTGCAGGAGGCGCGCGGGTTATCGCCCCTGATGCTGACGGCTTACTTCTGCCCCGTTGCTTTCTCGGGG
GCGGCGGCGGCGGTTGTCACGGGCTTGATGTTGGGGCCTTTACGGTTGGGGCCGCCTACTGTCATGACGGTTGCT
CTGGCTGCCTTTACCATTGGGTCTGTGTTGACGGCGGTGGCGCCCGTGCATCAGACGTACTGGGCGCAGTTGTTC
GTTGCTTTCCTGGTCATGCCCGTGGGGATGGACTGTTCGTTTCCGGCGTCGACGCTGATTGTGTCCAACGCGGTG
GCGAGGAGGCATCAGGGGGTTGGGGCGAGTCTTGTGAGTACCGTGGTCAACTATGGGATTGCGCTGGGGGTTGGC
TTCGCGGGCACGGCGGAGATGATGGAGTTGGATGGCTGTGAGGGCATCTAG
Transcript >Ophun1|6929
ATGCTGCAAGATGGCGGCCCGGATGCCACGTCGTCCAAGAAGAACATGTCGGATTCCAACGGAGAGGAGCCTGGC
ATCGAGGGGACGAGGGCTTGGGCTTCGCAGGGGATGACGCCTTGGAGGGAGGCTTTGCTGGTGTTTACGGCTTGC
ATGGCGCAGTTTTGCACGCAGACGGCTTTCTTCTCTACCCTCATCCTGCTGCGTCCCATCGGCGCCTCGTTCGGT
ATCGACAGTCCGGCGAGATTGGCCTGGCTGGTGGCCGCCTTCTCCCTCGCAGCCGGAACCCTCATCATCTTCTGC
GGCCGTCTGGGCGACGTCTTTGGCCACGGTCGGATGCTCATCCTGGGCTTCACCTGGTGGGCGGTCTGGTCGGCC
ATCTCAGGCCTCTCCGTCTACTCAACCTTCTACCTGTCCGTCATCTCGCGCGCCATGCAAGGCGTAGGCCCCGCC
GTGACGCTCCCCAACGCGCTGGCGGTGCTGGGAACGGCCTACCCGCCCGGCCACCGCAAAGCAATGGTCTTCGCC
ATGTTCGGGGCTGTGGCGCCGGTTGGGGCTGTTGTCGGGGGCGTCTTTGCTAGTTTGCTGGCTGAGGTTTGGTGG
CCTTGGGCTATGTGGGTTTTTGCGGCTTGGTTGCTTGTTTTGGCGGTTTTGGCGGGCTTTGCTGTGCCGTTGAGG
GATGAGCGGGATGATGATGATGATGATGGTGGTGGTGGTGAGAAGGGGGTTGCTTCTTCTTCTTCTTCTGCGGAG
CGGGGGTTTAAGGATACTTTGCTCGCACTCGACGTGCCAGCCGCCGTCATCGGAATCATGGCTCTCGTTCTCTTT
AGCTTCGCCTGGACACAAGCCCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCCCTCGTGGCAGGCCTC
GTCCTCTTCGCCCTCTTCCTCTACACGGAGACGAAGCTGAGTCCCTCACCGCTGGTCCCCTTCCAGGCCCTTACA
ACAGACGTGGCCTTTGTGCTAGCCGCCGTGCTGTGCGGCTGGGCGAGTTTCGGCGTGTGGACGCTCTACGTGGTG
TTGACGCTGCAGGAGGCGCGCGGGTTATCGCCCCTGATGCTGACGGCTTACTTCTGCCCCGTTGCTTTCTCGGGG
GCGGCGGCGGCGGTTGTCACGGGCTTGATGTTGGGGCCTTTACGGTTGGGGCCGCCTACTGTCATGACGGTTGCT
CTGGCTGCCTTTACCATTGGGTCTGTGTTGACGGCGGTGGCGCCCGTGCATCAGACGTACTGGGCGCAGTTGTTC
GTTGCTTTCCTGGTCATGCCCGTGGGGATGGACTGTTCGTTTCCGGCGTCGACGCTGATTGTGTCCAACGCGGTG
GCGAGGAGGCATCAGGGGGTTGGGGCGAGTCTTGTGAGTACCGTGGTCAACTATGGGATTGCGCTGGGGGTTGGC
TTCGCGGGCACGGCGGAGATGATGGAGTTGGATGGCTGTGAGGGCATCTAG
Gene >Ophun1|6929
ATGCTGCAAGATGGCGGCCCGGATGCCACGTCGTCCAAGAAGAACATGTCGGATTCCAACGGAGAGGAGCCTGGC
ATCGAGGGGACGAGGGCTTGGGCTTCGCAGGGGATGACGCCTTGGAGGGAGGCTTTGCTGGTGTTTACGGCTTGC
ATGGCGCAGTTTTGCACGCGTGAGGACTTACTTTGCTTTCCTTTCCAAAGGGGATGGATGCTGATGATGGTGTTT
GATGACCAGAGACGGCTTTCTTCTCTACCCTCATCCTGCTGCGTCCCATCGGCGCCTCGTTCGGTATCGACAGTC
CGGCGAGATTGGCCTGGCTGGTGGCCGCCTTCTCCCTCGCAGCCGGAACCCTCATCATCTTCTGCGGCCGTCTGG
GCGACGTCTTTGGCCACGGTCGGATGCTCATCCTGGGCTTCACCTGGTGGGCGGTCTGGTCGGCCATCTCAGGCC
TCTCCGTCTACTCAACCTTCTACCTGTCCGTCATCTCGCGCGCCATGCAAGGCGTAGGCCCCGCCGTGACGCTCC
CCAACGCGCTGGCGGTGCTGGGAACGGCCTACCCGCCCGGCCACCGCAAAGCAATGGTCTTCGCCATGTTCGGGG
CTGTGGCGCCGGTTGGGGCTGTTGTCGGGGGCGTCTTTGCTAGTTTGCTGGCTGAGGTTTGGTGGCCTTGGGCTA
TGTGGGTTTTTGCGGCTTGGTTGCTTGTTTTGGCGGTTTTGGCGGGCTTTGCTGTGCCGTTGAGGGATGAGCGGG
ATGATGATGATGATGATGGTGGTGGTGGTGAGAAGGGGGTTGCTTCTTCTTCTTCTTCTGCGGAGCGGGGGTTTA
AGGATACTTTGCTCGCACTCGACGTGCCAGCCGCCGTCATCGGAATCATGGCTCTCGTTCTCTTTAGCTTCGCCT
GGACACAAGCCCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCCCTCGTGGCAGGCCTCGTCCTCTTCG
CCCTCTTCCTCTACACGGAGACGAAGCTGAGTCCCTCACCGCTGGTCCCCTTCCAGGCCCTTACAACAGACGTGG
CCTTTGTGCTAGCCGCCGTGCTGTGCGGCTGGGCGAGTTTCGGCGTGTGGACGCTCTACGTGGTGTTGACGCTGC
AGGAGGCGCGCGGGTTATCGCCCCTGATGCTGACGGCTTACTTCTGCCCCGTTGCTTTCTCGGGGGCGGCGGCGG
CGGTTGTCACGGGCTTGATGTTGGGGCCTTTACGGTTGGGGCCGCCTACTGTCATGACGGTTGCTCTGGCTGCCT
TTACCATTGGGTCTGTGTTGACGGCGGTGGCGCCCGTGCATCAGACGTACTGGGCGCAGTTGTTCGTTGCTTTCC
TGGTCATGCCCGTGGGGATGGACTGTTCGTTTCCGGCGTCGACGCTGATTGTGTCCAACGCGGTGGCGAGGAGGC
ATCAGGGGGTTGGGGCGAGTCTTGTGAGTACCGTGGTCAACTATGGGATTGCGCTGGGGGTTGGCTTCGCGGGCA
CGGCGGAGATGTACGTTCGTGGCGAGGAGGATTCTGTCGAGGGGAGGCTTCGGGGGTTTCGGGGGGCGTTGTTTG
TTGGGGTTGGGCTTGCGGGGTTGGGGTTGGGGGTTTGTTTGGTGTTTGTGGTGAGGAAGGGGGGGTTTGGGAGGG
GGTTGTGAGGGGGTTGTATAGGGATGGAGTTGTTGTATAAGGATGGAGTTGGATGGCTGTGAGGGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail