Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6924
Gene name
LocationContig_80:17721..19557
Strand-
Gene length (bp)1836
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 7.4E-21 7 155
PF00179 UQ_con Ubiquitin-conjugating enzyme 2.6E-10 310 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66KB0|UBE2Z_XENTR Ubiquitin-conjugating enzyme E2 Z OS=Xenopus tropicalis GN=ube2z PE=2 SV=2 2 260 1.0E-33
sp|Q9H832|UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens GN=UBE2Z PE=1 SV=2 3 261 2.0E-33
sp|Q3B7D1|UBE2Z_RAT Ubiquitin-conjugating enzyme E2 Z OS=Rattus norvegicus GN=Ube2z PE=1 SV=2 3 261 2.0E-33
sp|Q3UE37|UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus GN=Ube2z PE=1 SV=2 3 261 2.0E-33
sp|Q6PCF7|UBE2Z_XENLA Ubiquitin-conjugating enzyme E2 Z OS=Xenopus laevis GN=ube2z PE=2 SV=2 3 260 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66KB0|UBE2Z_XENTR Ubiquitin-conjugating enzyme E2 Z OS=Xenopus tropicalis GN=ube2z PE=2 SV=2 2 260 1.0E-33
sp|Q9H832|UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens GN=UBE2Z PE=1 SV=2 3 261 2.0E-33
sp|Q3B7D1|UBE2Z_RAT Ubiquitin-conjugating enzyme E2 Z OS=Rattus norvegicus GN=Ube2z PE=1 SV=2 3 261 2.0E-33
sp|Q3UE37|UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus GN=Ube2z PE=1 SV=2 3 261 2.0E-33
sp|Q6PCF7|UBE2Z_XENLA Ubiquitin-conjugating enzyme E2 Z OS=Xenopus laevis GN=ube2z PE=2 SV=2 3 260 2.0E-33
sp|Q6DG60|UBE2Z_DANRE Ubiquitin-conjugating enzyme E2 Z OS=Danio rerio GN=ube2z PE=2 SV=2 3 264 6.0E-33
sp|Q5UQ88|UBC3_MIMIV Probable ubiquitin-conjugating enzyme E2 R521 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R521 PE=3 SV=1 31 164 7.0E-19
sp|Q11076|UBC17_CAEEL Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=3 SV=3 7 168 1.0E-18
sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 23 167 4.0E-16
sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 23 167 4.0E-16
sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens GN=UBE2O PE=1 SV=3 37 176 2.0E-13
sp|Q6ZPJ3|UBE2O_MOUSE (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O OS=Mus musculus GN=Ube2o PE=1 SV=3 37 176 2.0E-13
sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=Ubc6 PE=2 SV=2 7 155 2.0E-12
sp|F4HPP7|UBC39_ARATH Putative ubiquitin-conjugating enzyme E2 39 OS=Arabidopsis thaliana GN=UBC39 PE=3 SV=1 8 138 5.0E-12
sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1 312 436 6.0E-12
sp|P42745|UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1 312 436 9.0E-12
sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1 312 436 3.0E-11
sp|B4L7V4|UBE2S_DROMO Ubiquitin-conjugating enzyme E2 S OS=Drosophila mojavensis GN=GI11085 PE=3 SV=1 3 150 4.0E-11
sp|P23566|UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp6 PE=1 SV=3 7 155 4.0E-11
sp|Q9LUQ5|UBC25_ARATH Probable ubiquitin-conjugating enzyme E2 25 OS=Arabidopsis thaliana GN=UBC25 PE=2 SV=1 7 172 4.0E-11
sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1 7 152 6.0E-11
sp|Q6BU36|UBC2_DEBHA Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC2 PE=3 SV=1 7 155 6.0E-11
sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1 7 133 7.0E-11
sp|P35133|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1 7 133 8.0E-11
sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1 7 155 9.0E-11
sp|B4JKB7|UBE2S_DROGR Ubiquitin-conjugating enzyme E2 S OS=Drosophila grimshawi GN=GH12079 PE=3 SV=1 3 150 1.0E-10
sp|Q58FS2|UBC2_TRIHA Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1 7 156 1.0E-10
sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1 7 155 2.0E-10
sp|P42745|UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1 7 156 2.0E-10
sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1 7 155 2.0E-10
sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBC2 PE=2 SV=1 7 155 2.0E-10
sp|P35132|UBC9_ARATH SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1 7 133 2.0E-10
sp|Q8S920|UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica GN=UBC5A PE=2 SV=1 7 133 2.0E-10
sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1 7 164 2.0E-10
sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1 7 164 2.0E-10
sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1 7 164 2.0E-10
sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1 7 164 2.0E-10
sp|Q32P99|UBE2B_BOVIN Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1 7 164 2.0E-10
sp|Q8S919|UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B OS=Oryza sativa subsp. japonica GN=UBC5B PE=2 SV=1 7 133 2.0E-10
sp|Q94F47|UBC28_ARATH Ubiquitin-conjugating enzyme E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1 7 133 2.0E-10
sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1 312 436 3.0E-10
sp|Q6CUD9|UBC2_KLULA Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC2 PE=3 SV=1 7 155 3.0E-10
sp|P34477|UBC7_CAEEL Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1 1 148 3.0E-10
sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=1 SV=1 7 160 4.0E-10
sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=1 SV=2 7 160 4.0E-10
sp|B4N208|UBE2S_DROWI Ubiquitin-conjugating enzyme E2 S OS=Drosophila willistoni GN=GK16201 PE=3 SV=1 3 150 4.0E-10
sp|Q9C918|UBC38_ARATH Putative ubiquitin-conjugating enzyme E2 38 OS=Arabidopsis thaliana GN=UBC38 PE=3 SV=2 35 135 4.0E-10
sp|P42746|UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1 7 154 4.0E-10
sp|P06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD6 PE=1 SV=1 7 155 5.0E-10
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1 4 153 5.0E-10
sp|B4MA02|UBE2S_DROVI Ubiquitin-conjugating enzyme E2 S OS=Drosophila virilis GN=GJ15767 PE=3 SV=1 3 150 5.0E-10
sp|Q75EB8|UBC2_ASHGO Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC2 PE=3 SV=1 7 155 5.0E-10
sp|P35135|UBC4_SOLLC Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1 7 133 6.0E-10
sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=1 SV=1 313 440 7.0E-10
sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=1 SV=2 313 440 7.0E-10
sp|Q9FKT3|UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1 7 133 8.0E-10
sp|Q6FR76|UBC2_CANGA Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC2 PE=3 SV=1 7 155 9.0E-10
sp|B5DKM4|UBE2S_DROPS Ubiquitin-conjugating enzyme E2 S OS=Drosophila pseudoobscura pseudoobscura GN=GA22810 PE=3 SV=1 3 150 1.0E-09
sp|B4H9W2|UBE2S_DROPE Ubiquitin-conjugating enzyme E2 S OS=Drosophila persimilis GN=GL16001 PE=3 SV=1 3 150 1.0E-09
sp|P0CS16|UBC2_CRYNJ Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBC2 PE=3 SV=1 315 442 1.0E-09
sp|P0CS17|UBC2_CRYNB Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UBC2 PE=3 SV=1 315 442 1.0E-09
sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=1 SV=2 7 133 1.0E-09
sp|Q9C9Y7|UBC12_ARATH Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1 7 133 2.0E-09
sp|B3NWW9|UBE2S_DROER Ubiquitin-conjugating enzyme E2 S OS=Drosophila erecta GN=GG18165 PE=3 SV=1 3 150 2.0E-09
sp|Q9SLE4|UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1 7 153 2.0E-09
sp|P15731|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC4 PE=1 SV=1 7 128 2.0E-09
sp|B3MQV3|UBE2S_DROAN Ubiquitin-conjugating enzyme E2 S OS=Drosophila ananassae GN=GF21161 PE=3 SV=1 3 150 2.0E-09
sp|B4Q2J2|UBE2S_DROYA Ubiquitin-conjugating enzyme E2 S OS=Drosophila yakuba GN=GE15576 PE=3 SV=1 3 150 2.0E-09
sp|Q54I43|UBE2S_DICDI Ubiquitin-conjugating enzyme E2 S OS=Dictyostelium discoideum GN=ube2s PE=3 SV=1 5 163 3.0E-09
sp|Q4WLA7|UBC2_ASPFU Ubiquitin-conjugating enzyme E2 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ubc2 PE=3 SV=1 7 155 3.0E-09
sp|B4R6G1|UBE2S_DROSI Ubiquitin-conjugating enzyme E2 S OS=Drosophila simulans GN=GD17343 PE=3 SV=1 3 150 3.0E-09
sp|B4IF39|UBE2S_DROSE Ubiquitin-conjugating enzyme E2 S OS=Drosophila sechellia GN=GM13299 PE=3 SV=1 3 150 3.0E-09
sp|Q9VX25|UBE2S_DROME Ubiquitin-conjugating enzyme E2 S OS=Drosophila melanogaster GN=CG8188 PE=1 SV=2 3 150 3.0E-09
sp|A5PKP9|UB2D4_XENLA Ubiquitin-conjugating enzyme E2 D4 OS=Xenopus laevis GN=ube2d4 PE=1 SV=1 4 153 3.0E-09
sp|Q96UP5|UBC2_EMENI Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsJ PE=3 SV=1 7 155 4.0E-09
sp|Q553F3|UBC2_DICDI Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2 313 436 4.0E-09
sp|P78717|UBC2_NECHA Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1 7 156 5.0E-09
sp|P0CS16|UBC2_CRYNJ Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBC2 PE=3 SV=1 7 138 6.0E-09
sp|P0CS17|UBC2_CRYNB Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UBC2 PE=3 SV=1 7 138 6.0E-09
sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc15 PE=3 SV=1 8 141 6.0E-09
sp|Q9ZVX1|UBC23_ARATH Probable ubiquitin-conjugating enzyme E2 23 OS=Arabidopsis thaliana GN=UBC23 PE=1 SV=1 35 136 1.0E-08
sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-8 PE=3 SV=4 7 155 1.0E-08
sp|P52490|UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC13 PE=1 SV=1 7 149 1.0E-08
sp|Q8LGF7|PEX4_ARATH Protein PEROXIN-4 OS=Arabidopsis thaliana GN=PEX4 PE=1 SV=1 1 125 1.0E-08
sp|P42746|UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1 312 436 2.0E-08
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1 3 133 2.0E-08
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1 3 133 2.0E-08
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=1 SV=1 3 133 2.0E-08
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1 3 133 2.0E-08
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1 3 133 2.0E-08
sp|P70711|U2D2B_RAT Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=1 SV=1 4 133 2.0E-08
sp|Q6ZWY6|U2D2B_MOUSE Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=1 SV=1 4 133 2.0E-08
sp|Q4PFA5|UBC2_USTMA Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UBC2 PE=3 SV=1 5 155 2.0E-08
sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1 309 440 2.0E-08
sp|O74810|UBC1_SCHPO Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc1 PE=3 SV=2 7 128 3.0E-08
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1 3 153 3.0E-08
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=1 SV=1 3 153 3.0E-08
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1 3 153 3.0E-08
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1 3 153 3.0E-08
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1 3 153 3.0E-08
sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1 4 153 3.0E-08
sp|D3ZDK2|UB2D1_RAT Ubiquitin-conjugating enzyme E2 D1 OS=Rattus norvegicus GN=Ube2d1 PE=1 SV=1 4 145 3.0E-08
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1 4 145 3.0E-08
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1 4 145 3.0E-08
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1 4 145 3.0E-08
sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=Ubc6 PE=2 SV=2 313 439 4.0E-08
sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1 315 436 5.0E-08
sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1 313 440 5.0E-08
sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1 313 440 5.0E-08
sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1 313 440 5.0E-08
sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1 313 440 5.0E-08
sp|Q32P99|UBE2B_BOVIN Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1 313 440 5.0E-08
sp|Q6C093|UBC2_YARLI Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC2 PE=3 SV=1 7 139 5.0E-08
sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC5 PE=1 SV=1 7 128 5.0E-08
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1 3 133 5.0E-08
sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1 7 133 5.0E-08
sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=1 SV=1 30 145 5.0E-08
sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1 311 438 6.0E-08
sp|Q94A97|UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1 7 137 6.0E-08
sp|Q9FZ48|UBC36_ARATH Ubiquitin-conjugating enzyme E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1 7 128 7.0E-08
sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=1 SV=2 317 435 1.0E-07
sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc4 PE=1 SV=1 3 133 1.0E-07
sp|Q9UVR2|UBC1_MAGO7 Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBC1 PE=3 SV=2 3 133 1.0E-07
sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1 25 172 1.0E-07
sp|Q3ZCF7|UB2D3_BOVIN Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1 7 133 1.0E-07
sp|P25867|UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=2 SV=1 3 133 1.0E-07
sp|Q553F3|UBC2_DICDI Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2 7 156 2.0E-07
sp|P43102|UBC4_CANAX Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1 4 128 2.0E-07
sp|Q9P6I1|UBC16_SCHPO Ubiquitin-conjugating enzyme E2 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc16 PE=3 SV=2 1 126 2.0E-07
sp|Q8VY10|UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 24 OS=Arabidopsis thaliana GN=UBC24 PE=2 SV=1 5 153 2.0E-07
sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1 29 155 3.0E-07
sp|C3Z724|UBE2S_BRAFL Ubiquitin-conjugating enzyme E2 S OS=Branchiostoma floridae GN=BRAFLDRAFT_259979 PE=3 SV=1 3 150 3.0E-07
sp|Q95017|UBC9_CAEEL SUMO-conjugating enzyme UBC9 OS=Caenorhabditis elegans GN=ubc-9 PE=1 SV=1 291 373 3.0E-07
sp|Q5RF84|UB2G2_PONAB Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1 36 125 3.0E-07
sp|P60605|UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1 36 125 3.0E-07
sp|P60604|UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1 36 125 3.0E-07
sp|Q17QG5|UB2G2_BOVIN Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1 36 125 3.0E-07
sp|P0C8G4|UBC_ASFP4 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1 309 440 4.0E-07
sp|Q42541|UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1 30 145 5.0E-07
sp|P0C8G5|UBC_ASFWA Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=UBC PE=2 SV=1 25 148 5.0E-07
sp|Q02159|UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC7 PE=1 SV=1 7 125 5.0E-07
sp|P35128|UBE2N_DROME Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1 7 140 5.0E-07
sp|P0C8G5|UBC_ASFWA Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=UBC PE=2 SV=1 319 440 6.0E-07
sp|Q9LJZ5|UBC19_ARATH Ubiquitin-conjugating enzyme E2 19 OS=Arabidopsis thaliana GN=UBC19 PE=1 SV=1 7 146 6.0E-07
sp|Q4R4I1|UBE2N_MACFA Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1 7 141 7.0E-07
sp|P27949|UBC_ASFB7 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=UBC PE=2 SV=1 309 440 8.0E-07
sp|A7SE05|UBE2S_NEMVE Ubiquitin-conjugating enzyme E2 S OS=Nematostella vectensis GN=v1g237158 PE=3 SV=1 3 150 9.0E-07
sp|Q86K32|UBE2N_DICDI Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2 7 140 9.0E-07
sp|P78717|UBC2_NECHA Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1 315 439 1.0E-06
sp|Q4PFA5|UBC2_USTMA Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UBC2 PE=3 SV=1 315 439 1.0E-06
sp|Q42541|UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1 290 373 1.0E-06
sp|O13685|UBC13_SCHPO Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc13 PE=1 SV=1 7 128 1.0E-06
sp|Q9FF66|UBC22_ARATH Ubiquitin-conjugating enzyme E2 22 OS=Arabidopsis thaliana GN=UBC22 PE=1 SV=1 5 163 1.0E-06
sp|P42747|UBC14_ARATH Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=1 SV=1 30 147 1.0E-06
sp|P52485|UBCD2_DROME Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=Ubc2 PE=2 SV=1 315 371 1.0E-06
sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-8 PE=3 SV=4 315 439 2.0E-06
sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=UBC PE=2 SV=1 37 172 2.0E-06
sp|P0C8G4|UBC_ASFP4 Ubiquitin-conjugating enzyme E2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=UBC PE=2 SV=1 25 172 2.0E-06
sp|P52482|UB2E1_MOUSE Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=1 SV=1 274 371 2.0E-06
sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 3 141 2.0E-06
sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 3 141 2.0E-06
sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=1 SV=3 3 141 2.0E-06
sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 3 141 2.0E-06
sp|Q58FS2|UBC2_TRIHA Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1 315 439 4.0E-06
sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=1 SV=1 290 373 4.0E-06
sp|Q4WLA7|UBC2_ASPFU Ubiquitin-conjugating enzyme E2 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ubc2 PE=3 SV=1 315 439 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6924
MDQSIIRISKELSDIQKGSDLAIAVACRDIDVRNVKALIIGPHETPYEFGFFEVTSSPQPVSSLEYPSKAPNVQC
ITTNGGQCRLNPNIYANGKICFTWRGERGEEWSSAQGLESILLSIQSLLSSNPYENEPGFEDANEESDKKLQRAY
VQKIRHESLRLSVIQRLEGYLELNPDGSKQKKEDDSDESDDNTVPFEPFKDLIKRRFLWYYHSYLTAIEKGKSEV
KEGQGFIRMPFEAPNSNTMDGRFNYPDLERRLKRIKAALDAETKMWAVEGLAAIAKESTVSVNLQHQFDQVSASL
KRGDMPHVVTLEDGNPFVWILTYFGRPMTNLDGGLFRIRMSFSPRFPDEQPRVQFETKIFHHHVAEDGTACYTPN
PLKKEDIRCHIEAIVSTLEEDDPAYDPREIVNPEATRMFWAGGQADRKMYNRRLRRSVQQSMEDCVD*
Coding >Ophun1|6924
ATGGATCAGTCCATCATCCGCATCTCAAAGGAGCTCAGCGACATCCAGAAGGGCTCAGATCTCGCCATCGCCGTG
GCCTGCCGCGATATCGACGTCCGAAATGTCAAGGCCCTGATTATAGGGCCGCACGAGACGCCCTACGAGTTTGGT
TTCTTCGAGGTGACGTCTTCTCCTCAGCCCGTTTCCTCGCTAGAATATCCTTCCAAGGCACCAAACGTACAGTGT
ATCACCACAAATGGCGGTCAATGTCGGCTGAATCCCAATATCTATGCAAATGGAAAGATATGCTTCACGTGGCGG
GGCGAAAGGGGCGAGGAGTGGTCATCAGCGCAGGGCCTCGAGTCCATCCTGCTGTCCATCCAAAGCCTGCTCTCT
TCCAATCCATACGAGAACGAGCCCGGCTTCGAGGACGCCAACGAGGAGTCCGACAAGAAGTTGCAGAGAGCCTAT
GTTCAAAAGATCCGTCACGAGTCGCTGCGTCTTTCCGTCATACAACGGCTCGAAGGTTACCTGGAGTTGAACCCC
GACGGATCCAAGCAGAAAAAGGAAGACGACTCGGACGAGTCCGACGACAACACCGTACCTTTCGAGCCTTTCAAG
GACCTCATCAAGCGGCGCTTCCTCTGGTACTACCATTCATACTTGACGGCCATAGAGAAGGGCAAGTCGGAGGTC
AAGGAAGGCCAAGGGTTCATAAGAATGCCCTTTGAAGCGCCCAATAGCAACACTATGGATGGACGCTTCAACTAT
CCTGATCTGGAGCGCAGACTGAAGCGCATCAAGGCGGCTCTAGATGCAGAGACGAAGATGTGGGCCGTCGAAGGC
CTCGCCGCCATAGCCAAGGAGTCGACGGTCAGCGTGAACCTGCAGCATCAATTTGATCAGGTCTCCGCCTCGTTG
AAAAGAGGAGACATGCCGCACGTCGTAACACTCGAGGACGGCAACCCTTTCGTTTGGATCCTGACGTACTTTGGC
CGTCCCATGACGAACCTCGACGGAGGACTGTTTCGCATCAGGATGAGTTTCAGTCCTCGCTTCCCAGATGAGCAA
CCGCGCGTTCAGTTCGAGACAAAGATATTTCACCATCACGTCGCCGAAGATGGCACAGCCTGCTACACGCCCAAC
CCTCTGAAGAAGGAGGACATCCGGTGTCACATCGAGGCCATCGTTTCCACGCTCGAAGAGGATGATCCGGCCTAC
GACCCCAGAGAGATTGTCAATCCAGAAGCTACGCGAATGTTTTGGGCCGGCGGCCAGGCCGATCGGAAGATGTAC
AATCGGCGTCTGCGCCGGTCAGTGCAGCAGAGCATGGAGGATTGCGTGGACTGA
Transcript >Ophun1|6924
ATGGATCAGTCCATCATCCGCATCTCAAAGGAGCTCAGCGACATCCAGAAGGGCTCAGATCTCGCCATCGCCGTG
GCCTGCCGCGATATCGACGTCCGAAATGTCAAGGCCCTGATTATAGGGCCGCACGAGACGCCCTACGAGTTTGGT
TTCTTCGAGGTGACGTCTTCTCCTCAGCCCGTTTCCTCGCTAGAATATCCTTCCAAGGCACCAAACGTACAGTGT
ATCACCACAAATGGCGGTCAATGTCGGCTGAATCCCAATATCTATGCAAATGGAAAGATATGCTTCACGTGGCGG
GGCGAAAGGGGCGAGGAGTGGTCATCAGCGCAGGGCCTCGAGTCCATCCTGCTGTCCATCCAAAGCCTGCTCTCT
TCCAATCCATACGAGAACGAGCCCGGCTTCGAGGACGCCAACGAGGAGTCCGACAAGAAGTTGCAGAGAGCCTAT
GTTCAAAAGATCCGTCACGAGTCGCTGCGTCTTTCCGTCATACAACGGCTCGAAGGTTACCTGGAGTTGAACCCC
GACGGATCCAAGCAGAAAAAGGAAGACGACTCGGACGAGTCCGACGACAACACCGTACCTTTCGAGCCTTTCAAG
GACCTCATCAAGCGGCGCTTCCTCTGGTACTACCATTCATACTTGACGGCCATAGAGAAGGGCAAGTCGGAGGTC
AAGGAAGGCCAAGGGTTCATAAGAATGCCCTTTGAAGCGCCCAATAGCAACACTATGGATGGACGCTTCAACTAT
CCTGATCTGGAGCGCAGACTGAAGCGCATCAAGGCGGCTCTAGATGCAGAGACGAAGATGTGGGCCGTCGAAGGC
CTCGCCGCCATAGCCAAGGAGTCGACGGTCAGCGTGAACCTGCAGCATCAATTTGATCAGGTCTCCGCCTCGTTG
AAAAGAGGAGACATGCCGCACGTCGTAACACTCGAGGACGGCAACCCTTTCGTTTGGATCCTGACGTACTTTGGC
CGTCCCATGACGAACCTCGACGGAGGACTGTTTCGCATCAGGATGAGTTTCAGTCCTCGCTTCCCAGATGAGCAA
CCGCGCGTTCAGTTCGAGACAAAGATATTTCACCATCACGTCGCCGAAGATGGCACAGCCTGCTACACGCCCAAC
CCTCTGAAGAAGGAGGACATCCGGTGTCACATCGAGGCCATCGTTTCCACGCTCGAAGAGGATGATCCGGCCTAC
GACCCCAGAGAGATTGTCAATCCAGAAGCTACGCGAATGTTTTGGGCCGGCGGCCAGGCCGATCGGAAGATGTAC
AATCGGCGTCTGCGCCGGTCAGTGCAGCAGAGCATGGAGGATTGCGTGGACTGA
Gene >Ophun1|6924
ATGGATCAGTCCATCATCCGCATCTCAAAGGTAGGTTCGTCGTGCCCCGCATGATGCATCCCATCCCGCGGGGTC
GGTTGCGAGACGGTTGCGAGACGGTTGCGAGGCGAGGCGAGGCGAGGCGAGGCTGACAGCAAGCCGTCTTTAGGA
GCTCAGCGACATCCAGAAGGGCTCAGATCTCGGTGCGCTTGCCTGCTCGCTTCACGAATACGCCGGTACTAACCC
CCTTCTTCCGTCTTACCCAGCCATCGCCGTGGCCTGCCGCGATATCGACGTCCGAAATGTCAAGGCCCTGATTAT
AGGGCCGCACGAGACGCCCTACGAGTTTGGTTTCTTCGAGGTGACGTCTTCTCCTCAGCCCGTTTCCTCGCTAGG
TACCTATTCTAATGCTATTTGCAGTTTGCTGTTCGGTTTAACAAAGGTTGGCCCGTTTCCTCCCACCGTCCGAGT
CCCTCTTCTGACGGCCGCAGAATATCCTTCCAAGGCACCAAACGTACAGTGTATCACCACAAATGGCGGTCAATG
TCGGCTGAATCCCAATATCTATGCAAATGGAAAGATATGCTTGTGAGTCTTGTTCTGTCCGACGAGTCGCCTGCG
GGAATCCTGGGCTAAGATTATTCAGATCCATCCTCGGGTATGACGCCTCGTCTCTCACTTTCGTCGACCATGTCT
GACCGTTCGATAGCACGTGGCGGGGCGAAAGGGGCGAGGAGTGGTCATCAGCGCAGGGCCTCGAGTCCATCCTGC
TGTCCATCCAAAGCCTGCTCTCTTCCAATCCATACGAGAACGAGCCCGGCTTCGAGGACGCCAACGAGGAGTCCG
ACAAGAAGTTGCAGAGAGCCTATGTTCAAAAGGTGCGATGGATGGACTGGCCTGCTTGCTGTTAATGTCAGTCGC
TAACAGGTCGCAGATCCGTCACGAGTCGCTGCGTCTTTCCGTCATACAACGGCTCGAAGGTTACCTGGAGTTGAA
CCCCGACGGATCCAAGCAGAAAAAGGAAGACGACTCGGACGAGTCCGACGACAACACCGTACCTTTCGAGCCTTT
CAAGGACCTCATCAAGCGGCGCTTCCTCTGGTACTACCATTCATACTTGACGGCCATAGAGAAGGGCAAGTCGGA
GGTCAAGGAAGGCCAAGGGTTCATAAGAATGCCCTTTGAAGCGCCCAATAGCAACACTATGGATGGACGCTTCAA
CTATCCTGATCTGGAGCGCAGACTGAAGCGCATCAAGGCGGCTCTAGATGCAGAGACGAAGATGTGGGCCGTCGA
AGGCCTCGCCGCCATAGCCAAGGAGTCGACGGTCAGCGTGAACCTGCAGCATCAATTTGATCAGGTCTCCGCCTC
GTTGAAAAGAGGAGACATGCCGCACGTCGTAACACTCGAGGACGGCAACCCTTTCGTTTGGATCCTGACGTACTT
TGGCCGTCCCATGACGAACCTCGACGGAGGACTGTTTCGCATCAGGATGAGTTTCAGTCCTCGCTTCCCAGATGA
GCAACCGCGCGTTCAGTTCGAGACAAAGATATTTCACCATCACGTCGCCGAAGATGGCACAGCCTGCTACACGCC
CAACCCTCTGAAGAAGGAGGACATCCGGTGTCACATCGAGGCCATCGTTTCCACGCTCGAAGAGGATGATCCGGC
CTACGACCCCAGAGAGATTGTCAATCCAGAAGCTACGCGAATGTTTTGGGCCGGCGGCCAGGCCGATCGGAAGAT
GTACAATCGGCGTCTGCGCCGGTCAGTGCAGCAGAGCATGGAGTAGGTCGTCCCACGTTGCTCATGACGGACATT
CTGCTGACGGCTGGCTACAGGGATTGCGTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail