Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6919
Gene name
LocationContig_80:7710..9330
Strand+
Gene length (bp)1620
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10329 DUF2417 Region of unknown function (DUF2417) 4.1E-81 35 259

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13912|YDW6_SCHPO Uncharacterized protein C23C11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.06c PE=4 SV=1 33 520 1.0E-85
sp|P53925|YNL5_YEAST Uncharacterized vacuolar membrane protein YNL115C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL115C PE=1 SV=1 76 518 3.0E-30
sp|A6ZRW8|YNL5_YEAS7 Uncharacterized vacuolar membrane protein SCY_4679 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4679 PE=3 SV=1 76 518 3.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 124 22
3 131 153 22
4 158 177 19
5 206 228 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6919
MPLFSKANNDSDGDNEGRSSSQQPAHHDRQPPADERTRLLPARGDGMLAPDDPAVSPYNLWSIRILRYLTLFVTA
ITFAWWLVLLVSVFATPPGLNTRGSSFLAYGFTSLALANMLFTLVFFGVPSKSVRILAIVTAVMLFLDLVLLASV
QQTRYEEGWVGLVSATWALLMSIWALLADRAVKWGKEEEEERLTGRAETRRTLSEWLAVLLSTIAYVVMAVAVLL
MTLTIILRSLDAGLAAPGKLYEVDGGKYRIHIYCHGNATDQPTVLLEGGERPVEQGLWKLADKAVRNRSFSRYCF
VDRPGYGWSDTAPSPLSAGFAVDVLSEALAAADEKGPWVLASAGIGSLYSRVFSSRHAHEVRGLVLIDPLHEDLL
YEVASSGRGFLLWLRGIISPLGLDRLSGAIFRGRTSRDRIYGRSSSQGSKLIFTRLQENLVANSFTRRDVQGSRR
IQDQKTALVVISSGLEMKRSEDWAQKQRDLTKLTDNLKHWDVVDEAPHEVWESAEGSERIEERLRQMVHA*
Coding >Ophun1|6919
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAGCAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTCTGCCCGCCCGTGGGGATGGCATGCTCGCCCCT
GACGATCCTGCCGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTCTTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCTACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCGTATGGCTTCACCAGTCTGGCCTTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTTCGCATCCTGGCTATCGTCACGGCTGTGATGCTGTTCCTCGACCTGGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTGATGAGCATCTGGGCT
CTGCTCGCCGACCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACAGGCCGGGCCGAGACACGC
CGTACCCTGTCCGAGTGGCTGGCGGTGCTGCTATCGACTATCGCATACGTCGTCATGGCCGTGGCCGTCCTTCTC
ATGACGCTGACCATCATCCTGCGTTCTCTCGACGCCGGTTTAGCGGCCCCGGGCAAGCTGTACGAGGTGGACGGC
GGCAAATATCGGATTCACATCTACTGCCACGGCAACGCTACCGATCAGCCGACTGTGCTCTTGGAAGGCGGCGAG
AGGCCCGTCGAGCAGGGTCTATGGAAGCTGGCCGACAAGGCGGTGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTATCAGCCGGGTTCGCCGTCGATGTGCTC
AGCGAGGCGCTGGCAGCCGCCGACGAAAAGGGGCCGTGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTCTACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGCGGACTCGTCCTCATCGATCCCCTGCACGAGGATCTTCTC
TACGAGGTGGCCTCTTCTGGCCGCGGGTTCCTCCTCTGGCTGCGTGGCATCATCTCGCCTCTGGGACTGGACAGG
CTCTCAGGAGCCATCTTCCGAGGCCGAACGAGCCGAGACCGCATCTACGGCCGCTCCTCGTCACAGGGCAGCAAG
CTCATCTTCACCCGCCTGCAGGAGAACCTAGTCGCCAACTCGTTTACGCGTCGCGACGTGCAGGGCAGCCGACGG
ATCCAAGATCAGAAGACGGCGCTGGTCGTCATCAGCTCCGGCCTCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAACAGCGGGATCTGACCAAGTTGACGGACAATCTGAAGCATTGGGATGTGGTGGACGAGGCGCCTCATGAGGTG
TGGGAGTCTGCCGAGGGCAGTGAGCGGATTGAGGAGCGGTTGCGGCAGATGGTGCATGCTTGA
Transcript >Ophun1|6919
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAGCAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTCTGCCCGCCCGTGGGGATGGCATGCTCGCCCCT
GACGATCCTGCCGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTCTTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCTACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCGTATGGCTTCACCAGTCTGGCCTTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTTCGCATCCTGGCTATCGTCACGGCTGTGATGCTGTTCCTCGACCTGGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTGATGAGCATCTGGGCT
CTGCTCGCCGACCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACAGGCCGGGCCGAGACACGC
CGTACCCTGTCCGAGTGGCTGGCGGTGCTGCTATCGACTATCGCATACGTCGTCATGGCCGTGGCCGTCCTTCTC
ATGACGCTGACCATCATCCTGCGTTCTCTCGACGCCGGTTTAGCGGCCCCGGGCAAGCTGTACGAGGTGGACGGC
GGCAAATATCGGATTCACATCTACTGCCACGGCAACGCTACCGATCAGCCGACTGTGCTCTTGGAAGGCGGCGAG
AGGCCCGTCGAGCAGGGTCTATGGAAGCTGGCCGACAAGGCGGTGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTATCAGCCGGGTTCGCCGTCGATGTGCTC
AGCGAGGCGCTGGCAGCCGCCGACGAAAAGGGGCCGTGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTCTACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGCGGACTCGTCCTCATCGATCCCCTGCACGAGGATCTTCTC
TACGAGGTGGCCTCTTCTGGCCGCGGGTTCCTCCTCTGGCTGCGTGGCATCATCTCGCCTCTGGGACTGGACAGG
CTCTCAGGAGCCATCTTCCGAGGCCGAACGAGCCGAGACCGCATCTACGGCCGCTCCTCGTCACAGGGCAGCAAG
CTCATCTTCACCCGCCTGCAGGAGAACCTAGTCGCCAACTCGTTTACGCGTCGCGACGTGCAGGGCAGCCGACGG
ATCCAAGATCAGAAGACGGCGCTGGTCGTCATCAGCTCCGGCCTCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAACAGCGGGATCTGACCAAGTTGACGGACAATCTGAAGCATTGGGATGTGGTGGACGAGGCGCCTCATGAGGTG
TGGGAGTCTGCCGAGGGCAGTGAGCGGATTGAGGAGCGGTTGCGGCAGATGGTGCATGCTTGA
Gene >Ophun1|6919
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAGCAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTCTGCCCGCCCGTGGGGATGGCATGCTCGCCCCT
GACGATCCTGCCGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTCTTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCTACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCGTATGGCTTCACCAGTCTGGCCTTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTTCGCATCCTGGCTATCGTCACGGCTGTATGTCACTCTTCCATACTCTTCTCTTTCGAACTCCTC
TAACCGCCATGTTCTCAGGTGATGCTGTTCCTCGACCTGGTCCTGCTCGCCAGTGTACAGCAGACGCGCTATGAA
GAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTGATGAGCATCTGGGCTCTGCTCGCCGACCGAGCC
GTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGTTGACAGGCCGGGCCGAGACACGCCGTACCCTGTCCGAGTGG
CTGGCGGTGCTGCTATCGACTATCGCATACGTCGTCATGGCCGTGGCCGTCCTTCTCATGACGCTGACCATCATC
CTGCGTTCTCTCGACGCCGGTTTAGCGGCCCCGGGCAAGCTGTACGAGGTGGACGGCGGCAAATATCGGATTCAC
ATCTACTGCCACGGCAACGCTACCGATCAGCCGACTGTGCTCTTGGAAGGCGGCGAGAGGCCCGTCGAGCAGGGT
CTATGGAAGCTGGCCGACAAGGCGGTGCGCAACCGATCCTTCTCGCGCTACTGCTTCGTCGACCGTCCGGGCTAC
GGCTGGTCAGACACGGCGCCATCGCCGCTATCAGCCGGGTTCGCCGTCGATGTGCTCAGCGAGGCGCTGGCAGCC
GCCGACGAAAAGGGGCCGTGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTCTACTCGCGCGTCTTTTCGTCCCGA
CACGCGCACGAGGTCCGCGGACTCGTCCTCATCGATCCCCTGCACGAGGATCTTCTCTACGAGGTGGCCTCTTCT
GGCCGCGGGTTCCTCCTCTGGCTGCGTGGCATCATCTCGCCTCTGGGACTGGACAGGCTCTCAGGAGCCATCTTC
CGAGGCCGAACGAGCCGAGACCGCATCTACGGCCGCTCCTCGTCACAGGGCAGCAAGCTCATCTTCACCCGCCTG
CAGGAGAACCTAGTCGCCAACTCGTTTACGCGTCGCGACGTGCAGGGCAGCCGACGGATCCAAGATCAGAAGACG
GCGCTGGTCGTCATCAGCTCCGGCCTCGAGATGAAGCGCAGCGAGGACTGGGCGCAGAAACAGCGGGATCTGACC
AAGTTGACGGACAATCTGAAGCATTGGGATGTGGTGGACGAGGCGCCTCATGAGGTGTGGGAGTCTGCCGAGGGC
AGTGAGCGGATTGAGGAGCGGTTGCGGCAGATGGTGCATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail