Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6911
Gene name
LocationContig_8:72840..74539
Strand+
Gene length (bp)1699
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 9.3E-42 100 502

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 145 167 22
3 194 216 22
4 274 296 22
5 475 497 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6911
MTPHAEPCFDDKMVLVAPSDTDSDADVELDAAAPFLSKPSSPSKPMLRRGPSPLASVAACLASTPWRLLLLRLVN
FLTPSFLQRHHAREQTCPSRLSPTAYLDGMRGLAALFVYFCHYTYQAFFIARSWGYHGENYEILKLPFLRLWYQG
PQAVCVFFVISGYALSYRPLKLIRTRALPDFSATMSSLTFRRGLRLYLPPAISTLMIVCLLRLGAYEWTREFAND
RTFMRNVAEPHPARMDTTYEQLRDWSWQMYRFLHVFGWDMDGGRIPYDVHLWTIPVEFRCSLFLFLTIIGTARLR
TRFRLLVVAALLWFSYRHSRWDLILFLGGMLLAEWDLIRAAHVSPPALPQDEKAATAPARPLWKRGFWILVSIAG
IYLLCQPDEGGSDTPGWRLLTSMIPSWWTAEQYRFWQSAGAIVFVGAVGHSSGWQSFFNHPAIQYLGKISYALYL
MHGPAMHTVGYHFEKWAYSLTGVDGYWYNAGFVLGACFCVPTVIWWADVFWRAVDVPTVRFAKWVEGKCITKA*
Coding >Ophun1|6911
ATGACACCCCACGCCGAACCCTGCTTCGACGACAAGATGGTCCTCGTCGCTCCCTCAGACACGGACAGCGACGCC
GATGTCGAACTCGACGCCGCCGCTCCTTTTCTCAGCAAGCCTTCGTCCCCGAGCAAGCCCATGCTCCGCCGCGGC
CCGTCTCCCTTGGCCTCCGTCGCCGCCTGCTTGGCCTCGACGCCCTGGCGCCTCCTGCTACTACGCCTCGTCAAT
TTTCTCACGCCCAGTTTTCTCCAACGCCATCACGCCCGCGAACAAACATGCCCTTCACGCCTGTCACCTACCGCC
TACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTATCAGGCCTTCTTCATC
GCCAGGAGCTGGGGCTACCACGGCGAAAACTACGAAATCCTAAAACTCCCCTTCCTCCGTCTGTGGTATCAGGGC
CCCCAGGCCGTTTGCGTCTTCTTCGTCATCTCCGGCTACGCCTTGTCCTATCGTCCGCTCAAGCTGATTCGCACC
CGCGCTCTGCCCGACTTCTCCGCCACCATGAGCTCTCTGACCTTTCGTCGTGGCCTTCGCCTATACCTGCCCCCG
GCCATTTCCACCTTGATGATCGTTTGTCTCCTCCGCCTGGGAGCCTACGAATGGACCCGCGAGTTTGCCAACGAC
AGGACCTTTATGCGCAACGTGGCCGAGCCTCATCCCGCTCGCATGGACACTACCTACGAGCAGTTGAGGGACTGG
TCGTGGCAGATGTACAGATTCCTGCACGTCTTTGGTTGGGACATGGATGGCGGAAGAATTCCTTACGACGTGCAT
CTTTGGACCATTCCCGTCGAGTTCCGCTGCTCCCTCTTCCTCTTCCTCACCATCATCGGCACTGCCCGGCTGCGG
ACTAGGTTTCGGCTGCTGGTCGTGGCCGCTCTCCTCTGGTTCTCATACCGCCACTCGAGATGGGATCTGATACTC
TTCCTCGGCGGCATGCTCCTCGCCGAATGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCCGCCCTGCCTCAG
GACGAAAAGGCGGCGACTGCACCTGCACGTCCCTTGTGGAAAAGGGGGTTTTGGATCCTCGTCAGCATAGCAGGC
ATCTACCTGCTATGCCAGCCCGACGAAGGCGGAAGCGATACGCCCGGCTGGCGACTGCTGACGTCGATGATTCCG
TCTTGGTGGACGGCCGAGCAGTACCGCTTCTGGCAGTCGGCCGGCGCCATCGTCTTCGTCGGCGCCGTGGGCCAC
TCGAGCGGCTGGCAGAGCTTCTTCAACCACCCGGCCATCCAGTACCTGGGAAAGATCTCGTACGCTCTCTACCTC
ATGCACGGGCCGGCCATGCACACGGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACCGGGGTCGACGGT
TACTGGTACAACGCCGGCTTCGTCCTGGGAGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGGGCTGACGTGTTT
TGGAGAGCCGTCGACGTGCCGACGGTGCGGTTTGCCAAGTGGGTCGAGGGAAAGTGCATCACCAAGGCCTGA
Transcript >Ophun1|6911
ATGACACCCCACGCCGAACCCTGCTTCGACGACAAGATGGTCCTCGTCGCTCCCTCAGACACGGACAGCGACGCC
GATGTCGAACTCGACGCCGCCGCTCCTTTTCTCAGCAAGCCTTCGTCCCCGAGCAAGCCCATGCTCCGCCGCGGC
CCGTCTCCCTTGGCCTCCGTCGCCGCCTGCTTGGCCTCGACGCCCTGGCGCCTCCTGCTACTACGCCTCGTCAAT
TTTCTCACGCCCAGTTTTCTCCAACGCCATCACGCCCGCGAACAAACATGCCCTTCACGCCTGTCACCTACCGCC
TACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTATCAGGCCTTCTTCATC
GCCAGGAGCTGGGGCTACCACGGCGAAAACTACGAAATCCTAAAACTCCCCTTCCTCCGTCTGTGGTATCAGGGC
CCCCAGGCCGTTTGCGTCTTCTTCGTCATCTCCGGCTACGCCTTGTCCTATCGTCCGCTCAAGCTGATTCGCACC
CGCGCTCTGCCCGACTTCTCCGCCACCATGAGCTCTCTGACCTTTCGTCGTGGCCTTCGCCTATACCTGCCCCCG
GCCATTTCCACCTTGATGATCGTTTGTCTCCTCCGCCTGGGAGCCTACGAATGGACCCGCGAGTTTGCCAACGAC
AGGACCTTTATGCGCAACGTGGCCGAGCCTCATCCCGCTCGCATGGACACTACCTACGAGCAGTTGAGGGACTGG
TCGTGGCAGATGTACAGATTCCTGCACGTCTTTGGTTGGGACATGGATGGCGGAAGAATTCCTTACGACGTGCAT
CTTTGGACCATTCCCGTCGAGTTCCGCTGCTCCCTCTTCCTCTTCCTCACCATCATCGGCACTGCCCGGCTGCGG
ACTAGGTTTCGGCTGCTGGTCGTGGCCGCTCTCCTCTGGTTCTCATACCGCCACTCGAGATGGGATCTGATACTC
TTCCTCGGCGGCATGCTCCTCGCCGAATGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCCGCCCTGCCTCAG
GACGAAAAGGCGGCGACTGCACCTGCACGTCCCTTGTGGAAAAGGGGGTTTTGGATCCTCGTCAGCATAGCAGGC
ATCTACCTGCTATGCCAGCCCGACGAAGGCGGAAGCGATACGCCCGGCTGGCGACTGCTGACGTCGATGATTCCG
TCTTGGTGGACGGCCGAGCAGTACCGCTTCTGGCAGTCGGCCGGCGCCATCGTCTTCGTCGGCGCCGTGGGCCAC
TCGAGCGGCTGGCAGAGCTTCTTCAACCACCCGGCCATCCAGTACCTGGGAAAGATCTCGTACGCTCTCTACCTC
ATGCACGGGCCGGCCATGCACACGGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACCGGGGTCGACGGT
TACTGGTACAACGCCGGCTTCGTCCTGGGAGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGGGCTGACGTGTTT
TGGAGAGCCGTCGACGTGCCGACGGTGCGGTTTGCCAAGTGGGTCGAGGGAAAGTGCATCACCAAGGCCTGA
Gene >Ophun1|6911
ATGACACCCCACGCCGAACCCTGCTTCGACGACAAGATGGTCCTCGTCGCTCCCTCAGACACGGACAGCGACGCC
GATGTCGAACTCGACGCCGCCGCTCCTTTTCTCAGCAAGCCTTCGTCCCCGAGCAAGCCCATGCTCCGCCGCGGC
CCGTCTCCCTTGGCCTCCGTCGCCGCCTGCTTGGCCTCGACGCCCTGGCGCCTCCTGCTACTACGCCTCGTCAAT
TTTCTCACGCCCAGTTTTCTCCAACGCCATCACGCCCGCGAACAAACATGCCCTTCACGCCTGTCACCTACCGCC
TACCTCGACGGCATGCGCGGCTTGGCCGCCCTCTTCGTCTACTTCTGCCACTACACCTATCAGGCCTTCTTCATC
GCCAGGAGCTGGGGCTACCACGGCGAAAACTACGAAATCCTAAAACTCCCCTTCCTCCGTCTGTGGTATCAGGGC
CCCCAGGCCGTTTGCGTCTTCTTCGTCATCTCCGGCTACGCCTTGTCCTATCGTCCGCTCAAGCTGATTCGCACC
CGCGCTCTGCCCGACTTCTCCGCCACCATGAGCTCTCTGACCTTTCGTCGTGGCCTTCGCCTATACCTGCCCCCG
GCCATTTCCACCTTGATGATCGTTTGTCTCCTCCGCCTGGGAGCCTACGAATGGACCCGCGAGTTTGCCAACGAC
AGGACCTTTATGCGCAACGTGGCCGAGCCTCATCCCGCTCGCATGGACACTACCTACGAGCAGTTGAGGGACTGG
TCGTGGCAGATGTACAGATTCCTGCACGTCTTTGGTTGGGACATGGATGGCGGAAGAATTCGTGAGTTGCCCCGG
TCCCCTTGTTTTTTATTGTTTTTTTTCCTTTTTCTTGCCTTTTTCCCCTACTCTTCTCTCCCCTCTCCTTCCTCA
GCCTGAATCAACCTCGACGCTGACACTGTCTTGAACAGCTTACGACGTGCATCTTTGGACCATTCCCGTCGAGTT
CCGCTGCTCCCTCTTCCTCTTCCTCACCATCATCGGCACTGCCCGGCTGCGGACTAGGTTTCGGCTGCTGGTCGT
GGCCGCTCTCCTCTGGTTCTCATACCGCCACTCGAGATGGGATCTGATACTCTTCCTCGGCGGCATGCTCCTCGC
CGAATGGGATCTCATCCGCGCCGCGCACGTCAGTCCACCCGCCCTGCCTCAGGACGAAAAGGCGGCGACTGCACC
TGCACGTCCCTTGTGGAAAAGGGGGTTTTGGATCCTCGTCAGCATAGCAGGCATCTACCTGCTATGCCAGCCCGA
CGAAGGCGGAAGCGATACGCCCGGCTGGCGACTGCTGACGTCGATGATTCCGTCTTGGTGGACGGCCGAGCAGTA
CCGCTTCTGGCAGTCGGCCGGCGCCATCGTCTTCGTCGGCGCCGTGGGCCACTCGAGCGGCTGGCAGAGCTTCTT
CAACCACCCGGCCATCCAGTACCTGGGAAAGATCTCGTACGCTCTCTACCTCATGCACGGGCCGGCCATGCACAC
GGTCGGCTACCACTTCGAGAAGTGGGCGTACAGCCTGACCGGGGTCGACGGTTACTGGTACAACGCCGGCTTCGT
CCTGGGAGCTTGCTTCTGTGTGCCGACGGTCATCTGGTGGGCTGACGTGTTTTGGAGAGCCGTCGACGTGCCGAC
GGTGCGGTTTGCCAAGTGGGTCGAGGGAAAGTGCATCACCAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail