Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6900
Gene name
LocationContig_8:46171..48199
Strand+
Gene length (bp)2028
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.4E-24 197 506
PF00067 p450 Cytochrome P450 2.4E-09 541 598

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 386 597 2.0E-18
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 403 600 2.0E-17
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 201 597 2.0E-17
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 403 600 5.0E-17
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 361 592 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 386 597 2.0E-18
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 403 600 2.0E-17
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 201 597 2.0E-17
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 403 600 5.0E-17
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 361 592 5.0E-16
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 395 614 6.0E-16
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 177 601 1.0E-15
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 395 600 1.0E-15
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 403 600 2.0E-15
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 395 592 2.0E-15
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 395 592 2.0E-15
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 164 600 3.0E-15
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 164 600 4.0E-15
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 395 592 5.0E-15
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 347 594 5.0E-15
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 395 599 5.0E-15
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 398 622 6.0E-15
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 341 589 1.0E-14
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 403 600 2.0E-14
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 398 621 3.0E-14
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 403 600 3.0E-14
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 395 599 4.0E-14
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 398 621 4.0E-14
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 403 600 4.0E-14
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 142 600 4.0E-14
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 395 600 5.0E-14
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 396 598 5.0E-14
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 395 600 9.0E-14
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 403 615 9.0E-14
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 403 600 1.0E-13
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 403 600 1.0E-13
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 213 621 1.0E-13
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 308 601 1.0E-13
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 200 600 2.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 395 600 2.0E-13
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 395 600 3.0E-13
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 342 597 4.0E-13
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 201 599 4.0E-13
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 201 596 5.0E-13
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 390 594 1.0E-12
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 403 600 1.0E-12
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 398 622 1.0E-12
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 384 598 1.0E-12
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 396 592 1.0E-12
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 357 614 2.0E-12
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 395 602 2.0E-12
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 396 597 3.0E-12
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 395 600 3.0E-12
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 396 589 3.0E-12
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 396 593 3.0E-12
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 346 595 4.0E-12
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 328 597 4.0E-12
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 347 595 4.0E-12
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 259 596 4.0E-12
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 403 600 4.0E-12
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 401 592 4.0E-12
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 372 589 5.0E-12
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 401 592 5.0E-12
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 387 602 6.0E-12
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 343 601 6.0E-12
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 322 615 6.0E-12
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 395 600 9.0E-12
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 396 593 1.0E-11
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 395 600 1.0E-11
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 396 600 1.0E-11
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 350 599 1.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 396 594 2.0E-11
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 363 598 2.0E-11
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 322 622 2.0E-11
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 401 597 2.0E-11
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 322 615 2.0E-11
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 393 595 2.0E-11
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 403 600 2.0E-11
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 403 600 2.0E-11
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 329 600 4.0E-11
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 339 602 4.0E-11
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 398 622 6.0E-11
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 352 592 6.0E-11
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 395 611 7.0E-11
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 395 595 7.0E-11
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 395 600 9.0E-11
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 400 607 1.0E-10
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 404 614 1.0E-10
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 395 596 1.0E-10
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 386 622 1.0E-10
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 322 622 1.0E-10
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 363 594 1.0E-10
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 378 596 1.0E-10
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 200 600 2.0E-10
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 404 622 2.0E-10
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 409 579 2.0E-10
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 365 599 2.0E-10
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 308 592 2.0E-10
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 341 594 2.0E-10
sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 395 595 3.0E-10
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 388 594 3.0E-10
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 348 597 3.0E-10
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 395 599 3.0E-10
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 350 592 3.0E-10
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 395 592 3.0E-10
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 266 596 3.0E-10
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 395 592 3.0E-10
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 370 598 3.0E-10
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 307 593 4.0E-10
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 395 599 4.0E-10
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 368 589 4.0E-10
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 395 615 4.0E-10
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 192 596 5.0E-10
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 371 611 5.0E-10
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 404 601 5.0E-10
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 365 596 5.0E-10
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 316 599 5.0E-10
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 395 595 6.0E-10
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 308 596 7.0E-10
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 393 595 7.0E-10
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 396 592 8.0E-10
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 201 599 9.0E-10
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 213 621 9.0E-10
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 409 577 1.0E-09
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 378 594 1.0E-09
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 322 622 1.0E-09
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 400 596 1.0E-09
sp|Q9V4T3|C4AD1_DROME Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 310 601 1.0E-09
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 363 592 2.0E-09
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 357 595 2.0E-09
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 396 599 2.0E-09
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 363 594 2.0E-09
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 387 602 2.0E-09
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 297 621 2.0E-09
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 363 594 2.0E-09
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 396 592 2.0E-09
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 395 606 3.0E-09
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 396 593 3.0E-09
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 368 595 3.0E-09
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 329 615 3.0E-09
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 364 599 3.0E-09
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 396 592 4.0E-09
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 407 622 4.0E-09
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 366 607 4.0E-09
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 395 592 4.0E-09
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 365 599 4.0E-09
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 395 605 5.0E-09
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 395 599 5.0E-09
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 398 594 5.0E-09
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 363 594 5.0E-09
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 363 594 5.0E-09
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 393 595 5.0E-09
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 378 602 5.0E-09
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 404 594 6.0E-09
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 342 592 6.0E-09
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 400 594 6.0E-09
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 354 616 7.0E-09
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 363 599 7.0E-09
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 396 580 7.0E-09
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 395 592 7.0E-09
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 398 595 8.0E-09
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 119 621 8.0E-09
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 398 622 8.0E-09
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 313 590 8.0E-09
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 396 593 8.0E-09
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 347 594 9.0E-09
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 371 596 9.0E-09
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 362 620 1.0E-08
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 393 595 1.0E-08
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 331 594 1.0E-08
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 191 592 1.0E-08
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 399 594 1.0E-08
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 396 571 1.0E-08
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 396 592 1.0E-08
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 381 623 2.0E-08
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 396 580 2.0E-08
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 300 581 2.0E-08
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 365 597 2.0E-08
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 394 592 2.0E-08
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 363 592 2.0E-08
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 405 599 2.0E-08
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 395 573 2.0E-08
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 304 599 2.0E-08
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 380 599 2.0E-08
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 380 599 2.0E-08
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 393 595 2.0E-08
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 371 592 2.0E-08
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 347 594 2.0E-08
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 322 596 2.0E-08
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 322 596 2.0E-08
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 396 593 2.0E-08
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 395 599 3.0E-08
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 395 592 3.0E-08
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 405 573 3.0E-08
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 363 594 3.0E-08
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 371 595 3.0E-08
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 335 593 4.0E-08
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 395 592 4.0E-08
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 371 596 4.0E-08
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 316 597 4.0E-08
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 404 592 4.0E-08
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 363 597 5.0E-08
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 363 594 5.0E-08
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 395 592 5.0E-08
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 396 582 5.0E-08
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 291 595 5.0E-08
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 396 592 5.0E-08
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 405 598 6.0E-08
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 391 571 6.0E-08
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 369 599 7.0E-08
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 395 573 7.0E-08
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 396 592 7.0E-08
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 393 602 7.0E-08
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 395 622 8.0E-08
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 251 598 8.0E-08
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 354 606 8.0E-08
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 393 595 9.0E-08
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 354 606 9.0E-08
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 362 571 9.0E-08
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 400 602 1.0E-07
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 363 592 1.0E-07
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 377 621 1.0E-07
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 105 588 1.0E-07
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 385 596 1.0E-07
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 401 592 1.0E-07
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 391 594 1.0E-07
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 367 594 1.0E-07
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 363 597 1.0E-07
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 396 580 1.0E-07
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 398 621 2.0E-07
sp|Q16850|CP51A_HUMAN Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 368 623 2.0E-07
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 387 592 2.0E-07
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 363 593 2.0E-07
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 391 594 2.0E-07
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 395 592 2.0E-07
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 368 595 2.0E-07
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 396 592 2.0E-07
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 387 592 2.0E-07
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 365 602 2.0E-07
sp|Q4R8S6|CP51A_MACFA Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 368 623 2.0E-07
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 367 594 2.0E-07
sp|Q5RE72|CP51A_PONAB Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 368 623 2.0E-07
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 331 592 2.0E-07
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 363 598 2.0E-07
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 396 596 2.0E-07
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 363 593 2.0E-07
sp|P9WPN1|C135A_MYCTU Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 395 580 3.0E-07
sp|P9WPN0|C135A_MYCTO Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 395 580 3.0E-07
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 438 624 3.0E-07
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 363 593 3.0E-07
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 246 595 3.0E-07
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 404 592 3.0E-07
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 391 592 4.0E-07
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 395 596 4.0E-07
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 379 594 4.0E-07
sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 395 502 4.0E-07
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 364 592 4.0E-07
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 396 581 4.0E-07
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 396 503 4.0E-07
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 379 594 5.0E-07
sp|O46420|CP51A_PIG Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 368 623 5.0E-07
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 396 581 5.0E-07
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 393 580 5.0E-07
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 365 597 5.0E-07
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 391 594 5.0E-07
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 379 594 5.0E-07
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 401 583 6.0E-07
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 379 594 6.0E-07
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 145 605 6.0E-07
sp|Q9LJK2|ABAH4_ARATH Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 395 595 6.0E-07
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 382 598 6.0E-07
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 379 594 6.0E-07
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 386 592 6.0E-07
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 379 594 6.0E-07
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 331 592 7.0E-07
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 399 594 7.0E-07
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 396 595 7.0E-07
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 403 600 7.0E-07
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 396 595 7.0E-07
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 396 595 7.0E-07
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 364 575 8.0E-07
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 372 592 8.0E-07
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 391 594 1.0E-06
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 405 581 1.0E-06
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 388 612 1.0E-06
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 300 596 1.0E-06
sp|Q42569|C90A1_ARATH Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 391 599 1.0E-06
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 389 599 1.0E-06
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 396 599 1.0E-06
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 343 597 1.0E-06
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 381 601 2.0E-06
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 386 592 2.0E-06
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 396 594 2.0E-06
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 396 594 2.0E-06
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 394 610 2.0E-06
sp|Q59205|CPXU_BRADU Cytochrome P450 BJ-4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cyp117 PE=3 SV=2 368 581 2.0E-06
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 404 610 2.0E-06
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 395 597 2.0E-06
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 339 573 2.0E-06
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 387 580 3.0E-06
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 328 575 3.0E-06
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 395 592 3.0E-06
sp|Q4PJW3|CP51A_BOVIN Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 335 598 3.0E-06
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 396 580 3.0E-06
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 268 581 4.0E-06
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 360 571 4.0E-06
sp|Q64654|CP51A_RAT Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 395 623 4.0E-06
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 385 596 4.0E-06
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 379 592 5.0E-06
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 371 571 6.0E-06
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 409 577 7.0E-06
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 395 582 7.0E-06
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 395 582 7.0E-06
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 395 582 7.0E-06
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 344 582 7.0E-06
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 407 592 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6900
MAAPSPGKQNKHCVNQDEAMSPSAGILWPEDEQLLASGPAAAVLAVSTGSQPMMLLRPTTGVPDILTLAATLAAV
IVVALGLLYLRALPHPLPGIPYNAASARRLLGDVGEVRRARCRRRWIWSQPREHGAPVSQAFLLPFRRPTVIVSD
YRTAVDICSRRIKEFDKGSRTRECVGITTPNFHFTMQSSDPRFRLHRELLRDLMTPAFLHAVVAPRIYDRASLLV
RLWHLKHSLAGARPFAADHDLCLAMLDMISSAAFGMEKSEATLTRETTYLTCRLRSGPVLGPGPADAVVFPRAEQ
SPETEALLDIADMVSIAQGSPFPTLAQWLALLKPRHARAHWNRRRLLRRQTAKSLHRLAVAGDGSVPESALDELL
RREKMAASRAGRAPDFYSPDIRDEVLGYVLGGHDTTQALLAWWVKHMTRHQDIQAQLRRAIHAAHPVAKAQSRPP
TVEELVSASVPYLDAVLTESLRHSSVASLIVRKATCDTHILGYPIPSGTDILVCLTGPSVTEPALSIPEALRSET
SRAAKDRVPAWGDDVAEYRPERWLKDGAFDPQAGPTLAFSSGPRQCFGRKQAYLEMRTTATLLLWSFAFDPVDEA
LAGWEITESLLNLPRDCYVKLRKL*
Coding >Ophun1|6900
ATGGCGGCCCCATCTCCCGGGAAGCAGAACAAACATTGCGTGAACCAGGACGAAGCCATGTCGCCATCAGCCGGC
ATCCTCTGGCCCGAGGACGAGCAGCTGCTAGCCTCCGGGCCCGCGGCCGCGGTACTGGCAGTGTCCACCGGATCC
CAGCCCATGATGCTCCTCCGGCCCACGACGGGCGTCCCGGATATACTGACGCTGGCCGCCACGCTGGCAGCCGTC
ATCGTCGTCGCCCTCGGCCTGCTCTACCTCCGGGCCCTACCGCATCCCCTACCGGGAATCCCCTACAACGCGGCC
TCGGCTCGCCGGCTGCTGGGCGACGTGGGCGAAGTGCGCCGCGCCCGATGCCGACGCCGCTGGATCTGGAGCCAG
CCGAGGGAACACGGAGCTCCGGTCTCGCAGGCGTTTCTGCTGCCGTTTCGGCGGCCGACGGTGATTGTCTCGGAC
TATCGGACTGCTGTCGACATTTGCTCGCGGAGGATCAAGGAGTTTGATAAGGGGTCTCGCACGCGGGAGTGTGTG
GGCATCACGACGCCCAACTTTCACTTTACGATGCAGTCGAGTGATCCGCGGTTCCGGCTTCATCGTGAGCTGCTG
AGGGATCTGATGACGCCGGCGTTTTTACATGCGGTCGTCGCCCCTCGCATCTACGATAGAGCCTCTCTCCTCGTC
CGTCTCTGGCACCTCAAACACTCCCTCGCCGGCGCCCGTCCCTTCGCCGCAGACCACGACCTCTGCCTCGCAATG
CTAGACATGATCTCCAGCGCAGCCTTCGGCATGGAAAAGTCCGAGGCCACACTGACAAGAGAAACAACCTACCTC
ACATGCCGCCTCCGATCCGGCCCCGTCCTCGGCCCCGGCCCCGCAGACGCCGTCGTCTTCCCCCGCGCCGAGCAG
AGCCCCGAGACGGAAGCGCTGCTCGATATCGCCGACATGGTCTCCATCGCGCAGGGGAGTCCCTTTCCTACGCTG
GCTCAGTGGCTGGCTCTGCTGAAGCCGCGTCATGCCCGTGCTCACTGGAATCGTCGGAGGTTGTTGCGTCGGCAG
ACGGCTAAGAGTCTGCACCGGCTGGCCGTCGCTGGAGACGGGTCTGTGCCTGAGAGTGCGCTAGATGAGCTGCTG
AGGAGGGAGAAGATGGCGGCTTCGCGGGCGGGGAGGGCCCCTGACTTTTACTCGCCGGATATCCGGGACGAGGTC
CTCGGCTACGTTCTCGGCGGCCACGACACGACTCAGGCCCTCCTCGCCTGGTGGGTGAAGCACATGACGCGCCAT
CAAGACATCCAAGCCCAGCTCCGACGCGCCATACACGCCGCCCACCCCGTAGCCAAGGCCCAGTCCCGTCCGCCC
ACCGTCGAGGAGCTCGTCTCAGCCTCGGTGCCGTATCTCGACGCCGTGCTGACCGAGTCCCTGCGTCACTCATCC
GTAGCCTCGCTCATCGTCCGCAAGGCCACCTGCGACACCCACATCCTCGGCTACCCGATCCCTTCCGGCACCGAC
ATCCTCGTCTGCCTGACAGGCCCGTCAGTCACGGAGCCGGCGCTGTCCATCCCCGAGGCCCTCCGCTCCGAGACG
TCGAGGGCGGCCAAGGACCGTGTCCCGGCCTGGGGCGACGACGTGGCCGAGTACAGGCCTGAGAGATGGCTCAAG
GACGGCGCATTTGACCCGCAGGCCGGTCCGACGTTGGCCTTTTCCAGCGGGCCGAGGCAGTGTTTCGGTAGGAAG
CAGGCCTATCTGGAGATGAGGACGACGGCGACGTTGCTGCTGTGGAGCTTTGCGTTTGATCCCGTTGATGAAGCC
CTCGCCGGCTGGGAGATTACAGAGAGTCTGCTGAATCTGCCGAGGGACTGCTATGTCAAGCTCAGGAAGCTGTAG
Transcript >Ophun1|6900
ATGGCGGCCCCATCTCCCGGGAAGCAGAACAAACATTGCGTGAACCAGGACGAAGCCATGTCGCCATCAGCCGGC
ATCCTCTGGCCCGAGGACGAGCAGCTGCTAGCCTCCGGGCCCGCGGCCGCGGTACTGGCAGTGTCCACCGGATCC
CAGCCCATGATGCTCCTCCGGCCCACGACGGGCGTCCCGGATATACTGACGCTGGCCGCCACGCTGGCAGCCGTC
ATCGTCGTCGCCCTCGGCCTGCTCTACCTCCGGGCCCTACCGCATCCCCTACCGGGAATCCCCTACAACGCGGCC
TCGGCTCGCCGGCTGCTGGGCGACGTGGGCGAAGTGCGCCGCGCCCGATGCCGACGCCGCTGGATCTGGAGCCAG
CCGAGGGAACACGGAGCTCCGGTCTCGCAGGCGTTTCTGCTGCCGTTTCGGCGGCCGACGGTGATTGTCTCGGAC
TATCGGACTGCTGTCGACATTTGCTCGCGGAGGATCAAGGAGTTTGATAAGGGGTCTCGCACGCGGGAGTGTGTG
GGCATCACGACGCCCAACTTTCACTTTACGATGCAGTCGAGTGATCCGCGGTTCCGGCTTCATCGTGAGCTGCTG
AGGGATCTGATGACGCCGGCGTTTTTACATGCGGTCGTCGCCCCTCGCATCTACGATAGAGCCTCTCTCCTCGTC
CGTCTCTGGCACCTCAAACACTCCCTCGCCGGCGCCCGTCCCTTCGCCGCAGACCACGACCTCTGCCTCGCAATG
CTAGACATGATCTCCAGCGCAGCCTTCGGCATGGAAAAGTCCGAGGCCACACTGACAAGAGAAACAACCTACCTC
ACATGCCGCCTCCGATCCGGCCCCGTCCTCGGCCCCGGCCCCGCAGACGCCGTCGTCTTCCCCCGCGCCGAGCAG
AGCCCCGAGACGGAAGCGCTGCTCGATATCGCCGACATGGTCTCCATCGCGCAGGGGAGTCCCTTTCCTACGCTG
GCTCAGTGGCTGGCTCTGCTGAAGCCGCGTCATGCCCGTGCTCACTGGAATCGTCGGAGGTTGTTGCGTCGGCAG
ACGGCTAAGAGTCTGCACCGGCTGGCCGTCGCTGGAGACGGGTCTGTGCCTGAGAGTGCGCTAGATGAGCTGCTG
AGGAGGGAGAAGATGGCGGCTTCGCGGGCGGGGAGGGCCCCTGACTTTTACTCGCCGGATATCCGGGACGAGGTC
CTCGGCTACGTTCTCGGCGGCCACGACACGACTCAGGCCCTCCTCGCCTGGTGGGTGAAGCACATGACGCGCCAT
CAAGACATCCAAGCCCAGCTCCGACGCGCCATACACGCCGCCCACCCCGTAGCCAAGGCCCAGTCCCGTCCGCCC
ACCGTCGAGGAGCTCGTCTCAGCCTCGGTGCCGTATCTCGACGCCGTGCTGACCGAGTCCCTGCGTCACTCATCC
GTAGCCTCGCTCATCGTCCGCAAGGCCACCTGCGACACCCACATCCTCGGCTACCCGATCCCTTCCGGCACCGAC
ATCCTCGTCTGCCTGACAGGCCCGTCAGTCACGGAGCCGGCGCTGTCCATCCCCGAGGCCCTCCGCTCCGAGACG
TCGAGGGCGGCCAAGGACCGTGTCCCGGCCTGGGGCGACGACGTGGCCGAGTACAGGCCTGAGAGATGGCTCAAG
GACGGCGCATTTGACCCGCAGGCCGGTCCGACGTTGGCCTTTTCCAGCGGGCCGAGGCAGTGTTTCGGTAGGAAG
CAGGCCTATCTGGAGATGAGGACGACGGCGACGTTGCTGCTGTGGAGCTTTGCGTTTGATCCCGTTGATGAAGCC
CTCGCCGGCTGGGAGATTACAGAGAGTCTGCTGAATCTGCCGAGGGACTGCTATGTCAAGCTCAGGAAGCTGTAG
Gene >Ophun1|6900
ATGGCGGCCCCATCTCCCGGGAAGCAGAACAAACATTGCGTGAACCAGGACGAAGCCATGTCGCCATCAGCCGGC
ATCCTCTGGCCCGAGGACGAGCAGCTGCTAGCCTCCGGGCCCGCGGCCGCGGTACTGGCAGTGTCCACCGGATCC
CAGCCCATGATGCTCCTCCGGCCCACGACGGGCGTCCCGGATATACTGACGCTGGCCGCCACGCTGGCAGCCGTC
ATCGTCGTCGCCCTCGGCCTGCTCTACCTCCGGGCCCTACCGCATCCCCTACCGGGAATCCCCTACAACGCGGCC
TCGGCTCGCCGGCTGCTGGGCGACGTGGGCGAAGTGCGCCGCGCCCGATGCCGACGCCGCTGGATCTGGAGCCAG
CCGAGGGAACACGGAGCTCCGGTCTCGCAGGCGTTTCTGCTGCCGTTTCGGCGGCCGACGGTGATTGTCTCGGAC
TATCGGACTGCTGTCGACATTTGCTCGCGGAGGATCAAGGAGTTTGATAAGGGGTCTCGCACGCGGGAGTGTGTG
GGCATCACGACGCCCAACTTTCACTTTACGATGCAGTCGAGTGATCCGCGGTTCCGGCTTCATCGTGAGCTGCTG
AGGGATCTGATGACGCCGGCGTTTTTACATGCGGTACGTGTTCACTCTTATATGTATATATATATATACTATACA
TATATGCATCTGTTGACTGAACCTCCAGGTCGTCGCCCCTCGCATCTACGATAGAGCCTCTCTCCTCGTCCGTCT
CTGGCACCTCAAACACTCCCTCGCCGGCGCCCGTCCCTTCGCCGCAGACCACGACCTCTGCCTCGCAATGCTAGA
CATGATCTCCAGCGCAGCCTTCGGCATGGAAAAGTCCGAGGCCACACTGACAAGAGAAACAACCTACCTCACATG
CCGCCTCCGATCCGGCCCCGTCCTCGGCCCCGGCCCCGCAGACGCCGTCGTCTTCCCCCGCGCCGAGCAGAGCCC
CGAGACGGAAGCGCTGCTCGATATCGCCGACATGGTCTCCATCGCGCAGGGGAGTCCCTTTCCTACGCTGGCTCA
GTGGCTGGCTCTGCTGAAGCCGCGTCATGCCCGTGCTCACTGGAATCGTCGGAGGTTGTTGCGTCGGCAGACGGC
TAAGAGTCTGCACCGGCTGGCCGTCGCTGGAGACGGGTCTGTGCCTGAGAGTGCGCTAGATGAGCTGCTGAGGAG
GGAGAAGATGGCGGCTTCGCGGGCGGGGAGGGCCCCTGACTTTTACTCGCCGGATATCCGGGACGAGGTGAGCCC
CTTTTTCCAACCCCCTTTTCCCTTTCTCACTAATACATAATCCCCTTCACCATCTTCTCTTACTTACGTATCCAG
GTCCTCGGCTACGTTCTCGGCGGCCACGACACGACTCAGGCCCTCCTCGCCTGGTGGGTGAAGCACATGACGCGC
CATCAAGACATCCAAGCCCAGCTCCGACGCGCCATACACGCCGCCCACCCCGTAGCCAAGGCCCAGTCCCGTCCG
CCCACCGTCGAGGAGCTCGTCTCAGCCTCGGTGCCGTATCTCGACGCCGTGCTGACCGAGTCCCTGCGTCACTCA
TCCGTAGCCTCGCTCATCGTCCGCAAGGCCACCTGCGACACCCACATCCTCGGCTACCCGATCCCTTCCGGCACC
GACATCCTCGTCTGCCTGACAGGCCCGTCAGTCACGGAGCCGGCGCTGTCCATCCCCGAGGCCCTCCGCTCCGAG
ACGTCGAGGGCGGCCAAGGACCGTGTCCCGGCCTGGGGCGACGACGTGGCCGAGTACAGGCCTGAGAGATGGCTC
AAGGACGGCGCATTTGACCCGCAGGCCGGTCCGACGTTGGCCTTTTCCAGCGGGCCGAGGCAGTGTTTCGGTAGG
AAGCAGGCCTATCTGGAGATGAGGACGACGGCGACGTTGCTGCTGTGGAGCTTTGCGTTTGATCCCGTTGATGAA
GCCCTCGCCGGCTGGGAGATTACAGAGAGTCTGCTGAATCTGCCGAGGGACTGCTATGTCAAGCTCAGGAAGCTG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail