Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|69
Gene name
LocationContig_10:22899..23205
Strand-
Gene length (bp)306
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4906
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|69 (this protein)
Ophiocordyceps kimflemingae Ophio5|4627
Ophiocordyceps subramaniannii Hirsu2|1417
Ophiocordyceps subramaniannii Hirsu2|4462
Ophiocordyceps subramaniannii Hirsu2|5169
Ophiocordyceps subramaniannii Hirsu2|5170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|69
MSCHNRFRTNYLKIDRRDSYESCMAACDVMPECRSVEYEPRTKKCFYGTNTEHPTISAKAFLSAHSLGCAGACAS
CKKTGCDKKDNKPLPADAARCDDDPD*
Coding >Ophun1|69
ATGTCGTGCCACAACCGCTTTAGAACCAACTACCTCAAGATCGACAGGCGTGATTCCTACGAGTCGTGTATGGCC
GCCTGCGATGTCATGCCCGAGTGCCGCAGCGTCGAGTACGAGCCCCGGACCAAGAAGTGCTTCTACGGCACCAAC
ACCGAACACCCAACCATCTCAGCCAAGGCCTTCCTCAGCGCCCACTCTCTCGGTTGCGCCGGAGCCTGCGCCTCC
TGCAAGAAGACGGGCTGCGACAAGAAGGATAACAAGCCTCTCCCAGCCGACGCAGCTCGCTGTGACGACGATCCG
GACTAA
Transcript >Ophun1|69
ATGTCGTGCCACAACCGCTTTAGAACCAACTACCTCAAGATCGACAGGCGTGATTCCTACGAGTCGTGTATGGCC
GCCTGCGATGTCATGCCCGAGTGCCGCAGCGTCGAGTACGAGCCCCGGACCAAGAAGTGCTTCTACGGCACCAAC
ACCGAACACCCAACCATCTCAGCCAAGGCCTTCCTCAGCGCCCACTCTCTCGGTTGCGCCGGAGCCTGCGCCTCC
TGCAAGAAGACGGGCTGCGACAAGAAGGATAACAAGCCTCTCCCAGCCGACGCAGCTCGCTGTGACGACGATCCG
GACTAA
Gene >Ophun1|69
ATGTCGTGCCACAACCGCTTTAGAACCAACTACCTCAAGATCGACAGGCGTGATTCCTACGAGTCGTGTATGGCC
GCCTGCGATGTCATGCCCGAGTGCCGCAGCGTCGAGTACGAGCCCCGGACCAAGAAGTGCTTCTACGGCACCAAC
ACCGAACACCCAACCATCTCAGCCAAGGCCTTCCTCAGCGCCCACTCTCTCGGTTGCGCCGGAGCCTGCGCCTCC
TGCAAGAAGACGGGCTGCGACAAGAAGGATAACAAGCCTCTCCCAGCCGACGCAGCTCGCTGTGACGACGATCCG
GACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail