Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6888
Gene name
LocationContig_8:15567..20152
Strand+
Gene length (bp)4585
Transcript length (bp)4449
Coding sequence length (bp)4449
Protein length (aa) 1483

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2.5E-77 207 1449
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 1.9E-22 732 845

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 203 1456 0.0E+00
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 79 1462 0.0E+00
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 203 1455 0.0E+00
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 110 1455 0.0E+00
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 108 1455 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 203 1456 0.0E+00
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 79 1462 0.0E+00
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 203 1455 0.0E+00
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 110 1455 0.0E+00
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 108 1455 0.0E+00
sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 203 1452 0.0E+00
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 204 1455 0.0E+00
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 204 1457 3.0E-170
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 203 1158 6.0E-151
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 204 1455 3.0E-133
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 1253 1455 6.0E-86
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 207 1444 3.0E-64
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 210 1444 9.0E-64
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 206 1443 8.0E-55
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 205 1454 3.0E-50
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 213 1446 5.0E-48
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 212 1077 6.0E-37
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 205 1075 9.0E-37
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 206 1442 2.0E-36
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 205 1041 1.0E-35
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1300 1444 7.0E-33
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 205 948 7.0E-30
sp|Q8KBS6|SMC_CHLTE Chromosome partition protein Smc OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=smc PE=3 SV=1 205 1442 2.0E-29
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 1227 1442 4.0E-28
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 1302 1443 6.0E-28
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 1302 1443 6.0E-28
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 1302 1443 6.0E-28
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 1302 1443 6.0E-28
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 1308 1443 1.0E-27
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 738 1442 2.0E-27
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 1312 1454 1.0E-26
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 1253 1442 4.0E-26
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 210 995 5.0E-26
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 212 911 2.0E-25
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 1310 1454 2.0E-25
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 205 1120 2.0E-24
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 205 995 3.0E-24
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 1302 1443 6.0E-24
sp|P73340|SMC_SYNY3 Chromosome partition protein Smc OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=smc PE=3 SV=1 1265 1442 8.0E-24
sp|Q7NG51|SMC_GLOVI Chromosome partition protein Smc OS=Gloeobacter violaceus (strain PCC 7421) GN=smc PE=3 SV=1 1265 1442 8.0E-24
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 1297 1443 1.0E-23
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 210 1070 4.0E-23
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 210 924 7.0E-23
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 1242 1459 3.0E-22
sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 205 937 7.0E-22
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 1229 1453 1.0E-21
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 1310 1442 2.0E-20
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 210 967 2.0E-20
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 1072 1442 2.0E-20
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 205 877 3.0E-20
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 205 877 3.0E-20
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 205 877 4.0E-20
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 205 877 4.0E-20
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 205 877 4.0E-20
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 1310 1442 7.0E-20
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 1265 1442 2.0E-19
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacter versatilis (strain Ellin345) GN=smc PE=3 SV=1 1231 1442 2.0E-19
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 1265 1455 5.0E-19
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 210 1026 6.0E-19
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 210 1063 1.0E-18
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 207 468 2.0E-18
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 212 953 3.0E-18
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 1253 1442 4.0E-18
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 1256 1455 1.0E-17
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 1276 1442 1.0E-17
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 1264 1442 3.0E-17
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 210 871 3.0E-17
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 1282 1455 7.0E-17
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 1240 1455 9.0E-17
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 210 382 1.0E-16
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 1282 1455 1.0E-16
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 1265 1442 2.0E-16
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 1282 1455 2.0E-16
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 1283 1442 7.0E-16
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 1242 1455 7.0E-16
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 784 1467 2.0E-15
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 205 763 3.0E-15
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 205 881 3.0E-15
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 210 870 6.0E-15
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 1349 1475 9.0E-15
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 1309 1446 3.0E-14
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 1309 1446 3.0E-14
sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 1308 1448 4.0E-14
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 1362 1439 4.0E-14
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 210 358 1.0E-13
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 1252 1442 1.0E-13
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 210 358 5.0E-13
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 1308 1448 6.0E-13
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 1308 1448 6.0E-13
sp|P15016|YAT3_RHORU Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment) OS=Rhodospirillum rubrum PE=4 SV=1 1312 1442 6.0E-13
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 1308 1448 7.0E-13
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 1308 1448 9.0E-13
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 1349 1440 1.0E-12
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 207 816 1.0E-12
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 207 805 1.0E-12
sp|Q9CBT5|SMC_MYCLE Chromosome partition protein Smc OS=Mycobacterium leprae (strain TN) GN=smc PE=3 SV=1 1309 1442 1.0E-12
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 1270 1465 2.0E-12
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 1286 1441 4.0E-12
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 204 321 5.0E-12
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 1368 1440 8.0E-12
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 1368 1464 1.0E-11
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 207 1003 1.0E-11
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 1364 1452 2.0E-11
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 207 427 2.0E-11
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 1368 1455 2.0E-11
sp|B2FDA8|SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans GN=smc-3 PE=1 SV=1 212 937 2.0E-11
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 1350 1442 4.0E-11
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 1341 1441 4.0E-11
sp|B2FDA8|SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans GN=smc-3 PE=1 SV=1 1291 1464 9.0E-11
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 212 382 2.0E-10
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 1235 1440 3.0E-10
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 1362 1470 1.0E-09
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 1362 1451 3.0E-09
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 723 950 3.0E-09
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 1368 1428 7.0E-09
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 212 413 8.0E-09
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 1360 1453 8.0E-09
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 207 587 8.0E-09
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 207 361 8.0E-09
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 704 870 1.0E-08
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 1362 1453 2.0E-08
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 207 383 2.0E-08
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 215 338 2.0E-08
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 1310 1442 4.0E-08
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 728 870 5.0E-08
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 207 413 5.0E-08
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 207 515 6.0E-08
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 215 338 2.0E-07
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 210 461 3.0E-07
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 215 541 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0051276 chromosome organization Yes
GO:0005694 chromosome Yes
GO:0005515 protein binding Yes
GO:0071840 cellular component organization or biogenesis No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2702
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3713
Ophiocordyceps australis map64 (Brazil) OphauB2|6691
Ophiocordyceps camponoti-floridani Ophcf2|02150
Ophiocordyceps camponoti-rufipedis Ophun1|6888 (this protein)
Ophiocordyceps kimflemingae Ophio5|5937
Ophiocordyceps subramaniannii Hirsu2|4214

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6888
MSEVTPSRPSRRAANRRTIIDSDSDSNDTATAVEAEDDFTPEPARASRRQTRGGRQSMAPPTTAAPRPRGRPKKV
SAPAAESSQSADATDPNETAQISPEDTMPKLSPRKRKSTAPRPSGAAVSELAPPTPKPSTSPEPSQLRGTPLADI
TAVGANTQNPDATVAALKPVKPFDTVMERPMDIILKQRTAAVPVVEEATEPKPRIVLTYLILNNFKSYAGRQEVG
PFHASFSSVVGPNGSGKSNVIDSLLFVFGFRASKMRQGKISALIHNSAHYPNLDFCEVEVHFEEPGGGHEVVPDS
ALVISRKAFRNNSSKYYINGKESNFTTVTTLLRERGVDLDHKRFLILQGEVESIAQMKAKAANEHEDGLLEYLED
IIGTSKYKTPIEEAATEVETLNDVCVEKSGRVQHVEKEKQGLEDKKNKALDYIRDENELVMKKSSLYQLYIHECN
DNLSVTQEAVTQMQDQLDEELEKHQGSAQIIEELQKQYAVGSQDYSGQEKYSQSLTKHLAKLDQERVKLDEKRKF
LEDKKKKLEKTMSNAEKSTAEAEQTIEACSQDIESRTREVAALEEQVKSEEAELAKIRDSLKGKTQAFSDKIAAK
LKALEPWTEKINQKQSAIAVAESESNILREKANAGAVALEELQAKMASIEEVKAAKAEELKECETEKQTLQKEAD
KMMSELQVLSEQEPKLRSKISSARQKADEARSSLASTQTRGNVLAALMRMKESGRIDGFHGRLGNLGTIDPKYDV
AVSTACPSLDNFVTQTVEAGQQCIEYLRKNNLGRGNFICLDKLRARDLSTMETPEGAPRLFDLVKAKADEFRPAF
YHAMQDTLVAKDLAQANRIAYGAKRWRVVTLQGELIDKSGTMSGGGSTVKKGLMSSKLVADTSKEAVAKLEVDLD
AWETKFREFQEYQRECEGRLKELREQIPQLDTKMQKLGLEVESATRNMADVQRRIGDVSKEHQPSADDSRRLKTL
QKEVAKLNGEIDQLRGETASAEAEIKTLQDAIMEVGGERLQAQRAKVDALKGETVSHNEETSNAEVRRAKAEKQM
AKLAKDVAKASSERDAAADDLEKLEVDMGSQGERVEELKTLVQETEEGLVAKKEELAEFKEALDAKTAELNESRA
VEIEMRNKLEENQKALAENEKRHRYWNDKLSKLVLQSIDDLTGGVSPAKAAQGGEGEMREVKEEDEEDGERQQGG
ADDDGDVDMTDAPDEDMTDPPDEDEDQGQPQELPRHTPDELAGMSKETLKGEIAALEEKTEKVNVDLGVLAEYRR
RVEEHAARSSDLQSAITQRDAAKKRCDDLRRLRLEGFMAGFGAISLRLKEMYQMITMGGNAELELVDSLDPFSEG
ILFSVMPPKKSWKNIGNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFVV
ISLRNNMFELASRLVGVYKVNHMTRNVTIDNLDYISRDQQQQQQPAGPGQTTTLALR*
Coding >Ophun1|6888
ATGTCGGAGGTCACTCCCTCCCGCCCTTCGCGTCGCGCCGCGAACAGACGGACTATCATCGACTCCGACTCCGAT
TCGAACGACACCGCCACTGCTGTCGAAGCCGAAGATGACTTCACGCCGGAGCCTGCAAGAGCCAGTCGCAGGCAG
ACGCGAGGCGGGCGTCAGTCTATGGCCCCACCTACTACCGCCGCGCCGCGTCCTCGAGGACGACCTAAGAAGGTT
TCGGCTCCAGCCGCGGAATCATCGCAGTCTGCAGACGCGACGGATCCCAACGAGACTGCACAGATAAGTCCTGAA
GATACGATGCCGAAGCTCTCTCCGCGTAAACGCAAGAGTACGGCTCCGCGACCCTCTGGCGCTGCTGTGTCTGAA
CTGGCGCCGCCGACCCCGAAGCCTTCGACATCGCCGGAGCCTTCGCAGCTTCGTGGAACGCCTCTGGCTGACATC
ACCGCTGTTGGAGCAAATACCCAAAACCCCGACGCCACCGTGGCTGCCTTGAAGCCGGTAAAGCCGTTTGACACC
GTCATGGAGAGGCCCATGGATATCATACTCAAACAACGCACGGCTGCCGTGCCTGTCGTCGAGGAGGCCACAGAA
CCCAAGCCTCGCATTGTGCTGACCTATCTCATTCTGAACAACTTCAAGAGCTATGCTGGTCGTCAAGAAGTTGGC
CCTTTTCACGCCTCCTTCTCATCTGTCGTTGGTCCCAATGGTTCGGGCAAGTCAAACGTTATCGATTCGCTGCTG
TTTGTCTTTGGCTTCCGAGCCAGCAAAATGCGGCAAGGAAAAATCTCTGCTCTGATCCACAACTCGGCGCATTAT
CCAAACCTGGACTTTTGCGAGGTCGAAGTTCATTTTGAAGAACCTGGCGGTGGTCACGAGGTCGTCCCCGACTCT
GCTCTCGTCATCTCGCGCAAGGCATTTCGCAACAACTCGAGCAAGTACTATATCAATGGAAAAGAGTCCAATTTT
ACCACAGTCACGACCCTTCTCCGCGAAAGAGGCGTCGACTTGGACCATAAACGCTTTCTCATTCTACAAGGAGAG
GTCGAGTCGATTGCCCAGATGAAGGCCAAGGCGGCCAACGAGCACGAGGACGGTCTGCTCGAGTATCTCGAGGAC
ATCATCGGGACGTCAAAGTACAAGACACCTATCGAAGAGGCCGCCACCGAGGTCGAAACTCTCAATGATGTCTGT
GTCGAGAAGAGCGGTCGCGTGCAGCACGTGGAAAAGGAGAAGCAAGGCCTCGAAGACAAGAAGAACAAGGCGCTT
GACTATATACGAGACGAGAACGAACTGGTCATGAAGAAGTCGAGTCTCTATCAGTTATACATCCACGAGTGCAAC
GACAACCTCTCGGTCACGCAAGAGGCCGTCACCCAAATGCAAGATCAACTCGACGAGGAGCTTGAGAAGCACCAA
GGCAGCGCGCAGATTATTGAAGAGCTGCAGAAGCAATATGCGGTCGGCAGCCAGGACTACAGCGGACAGGAGAAA
TACTCGCAGTCTTTGACGAAGCACTTGGCCAAGCTCGATCAGGAGCGCGTCAAGCTCGACGAGAAGCGCAAGTTC
CTCGAGGACAAGAAGAAGAAACTGGAAAAGACGATGAGCAACGCCGAGAAGTCGACAGCCGAGGCCGAGCAGACA
ATAGAAGCGTGCAGCCAAGACATCGAGTCCCGCACTCGCGAGGTGGCAGCTCTGGAAGAACAGGTCAAGTCAGAA
GAGGCCGAGCTTGCCAAAATTCGAGACAGCCTCAAGGGCAAGACGCAGGCATTCTCTGATAAAATTGCGGCCAAG
CTTAAGGCGCTCGAGCCCTGGACGGAAAAGATTAACCAGAAGCAGTCGGCCATAGCTGTGGCGGAGAGCGAGAGC
AACATCTTGCGCGAAAAGGCCAACGCTGGTGCTGTGGCTCTCGAGGAGCTGCAAGCCAAGATGGCGTCCATCGAG
GAAGTCAAGGCCGCCAAGGCGGAGGAGCTCAAGGAGTGCGAGACGGAGAAGCAGACGCTGCAGAAGGAGGCCGAC
AAGATGATGTCGGAACTGCAAGTTCTCTCAGAGCAGGAGCCCAAGCTCCGTTCCAAAATCTCCAGCGCTCGACAA
AAGGCCGACGAGGCCCGTTCCAGCCTGGCCAGCACGCAGACGCGAGGCAACGTCCTGGCGGCCCTCATGCGGATG
AAGGAATCGGGCCGTATCGACGGCTTTCACGGCCGGCTGGGAAACCTCGGCACCATCGACCCCAAGTACGACGTG
GCCGTCTCTACGGCTTGTCCTTCGCTGGACAATTTTGTTACTCAGACAGTCGAGGCTGGCCAGCAGTGTATTGAG
TATCTGAGGAAGAACAACCTGGGACGTGGCAACTTCATCTGTCTCGACAAGCTGAGAGCCCGAGACCTCTCGACT
ATGGAGACGCCCGAGGGAGCTCCGCGCCTGTTTGACCTGGTCAAGGCCAAGGCAGACGAGTTTCGGCCGGCTTTC
TACCACGCCATGCAGGACACTCTGGTAGCGAAGGACCTGGCCCAGGCCAACCGGATCGCGTACGGGGCCAAGAGG
TGGCGTGTCGTCACGCTCCAGGGCGAGCTCATCGACAAGTCCGGCACCATGTCCGGCGGTGGCTCGACAGTCAAG
AAGGGCCTCATGTCGTCGAAGCTCGTGGCCGACACTAGCAAGGAAGCCGTGGCCAAGCTCGAGGTCGACCTGGAC
GCGTGGGAGACCAAGTTCCGCGAGTTTCAGGAGTACCAGCGGGAGTGCGAGGGGAGGCTGAAGGAGCTGAGAGAG
CAGATTCCCCAGCTCGACACCAAGATGCAGAAGCTGGGACTCGAGGTGGAGAGCGCGACGCGGAACATGGCCGAC
GTGCAGCGGCGGATTGGCGACGTCAGCAAGGAGCATCAGCCGTCTGCCGACGACTCTCGCCGGCTGAAGACGCTA
CAGAAGGAGGTGGCCAAGCTCAACGGCGAGATCGACCAGCTGCGTGGCGAGACGGCCAGTGCCGAGGCCGAGATC
AAGACGCTGCAAGATGCCATCATGGAGGTTGGAGGCGAGCGGCTTCAGGCGCAGAGGGCCAAGGTGGACGCACTC
AAGGGCGAGACGGTCTCACACAACGAAGAGACGTCGAATGCCGAGGTCCGTCGCGCCAAGGCAGAGAAGCAGATG
GCTAAGCTGGCCAAGGACGTGGCCAAGGCATCGAGTGAGAGGGATGCAGCCGCCGACGACCTGGAGAAGCTAGAG
GTCGACATGGGCAGCCAGGGAGAGCGAGTTGAGGAGCTCAAGACGCTCGTTCAGGAGACGGAAGAGGGTCTGGTG
GCCAAGAAAGAGGAGCTGGCCGAGTTCAAGGAGGCTCTGGACGCCAAGACGGCCGAGCTGAACGAGAGTCGGGCG
GTAGAGATTGAGATGCGCAACAAGCTCGAGGAGAACCAGAAGGCGCTGGCAGAGAACGAGAAGCGTCATCGATAC
TGGAACGACAAGCTCTCCAAGCTCGTGTTGCAGAGCATCGACGATCTAACGGGGGGTGTCTCTCCCGCCAAGGCA
GCCCAGGGCGGTGAAGGCGAGATGAGGGAGGTCAAGGAAGAAGACGAGGAAGATGGGGAGAGGCAGCAGGGAGGA
GCCGACGACGACGGAGACGTGGACATGACGGACGCCCCCGACGAGGACATGACGGACCCCCCTGACGAGGATGAG
GACCAGGGCCAGCCCCAGGAGCTGCCGAGGCACACGCCGGACGAGCTCGCGGGCATGAGCAAGGAGACACTCAAG
GGCGAAATCGCGGCGCTGGAGGAGAAGACGGAAAAGGTCAATGTCGACCTCGGGGTGCTGGCAGAGTACCGACGG
CGAGTCGAGGAGCACGCAGCTCGCTCGTCCGACCTGCAGTCGGCTATCACGCAGCGCGACGCGGCCAAGAAGCGA
TGCGACGACCTCCGAAGGCTGCGGCTCGAGGGCTTCATGGCCGGCTTCGGCGCCATCTCGCTCCGGCTCAAGGAG
ATGTACCAGATGATCACGATGGGCGGAAACGCCGAGCTGGAGCTGGTCGACAGCCTGGACCCCTTTAGCGAGGGC
ATCCTCTTCAGCGTGATGCCGCCCAAGAAGAGCTGGAAGAACATTGGCAACCTGTCGGGAGGCGAGAAGACGCTG
AGCAGCCTGGCCTTGGTGTTTGCGTTGCACCACTACAAGCCGACGCCGCTGTACGTCATGGACGAGATTGACGCG
GCGCTGGACTTTAGAAACGTGTCTATTGTGGCCAACTACATCAAGGAGCGGACCAAGAACGCACAATTTGTCGTC
ATCTCGCTGCGGAACAACATGTTTGAGCTGGCGTCCAGGCTTGTGGGAGTTTACAAGGTCAACCATATGACGAGG
AACGTGACGATTGACAACCTGGACTACATCTCGCGGGACCAGCAGCAGCAGCAGCAGCCTGCGGGCCCGGGACAG
ACGACGACGCTGGCCCTGAGGTGA
Transcript >Ophun1|6888
ATGTCGGAGGTCACTCCCTCCCGCCCTTCGCGTCGCGCCGCGAACAGACGGACTATCATCGACTCCGACTCCGAT
TCGAACGACACCGCCACTGCTGTCGAAGCCGAAGATGACTTCACGCCGGAGCCTGCAAGAGCCAGTCGCAGGCAG
ACGCGAGGCGGGCGTCAGTCTATGGCCCCACCTACTACCGCCGCGCCGCGTCCTCGAGGACGACCTAAGAAGGTT
TCGGCTCCAGCCGCGGAATCATCGCAGTCTGCAGACGCGACGGATCCCAACGAGACTGCACAGATAAGTCCTGAA
GATACGATGCCGAAGCTCTCTCCGCGTAAACGCAAGAGTACGGCTCCGCGACCCTCTGGCGCTGCTGTGTCTGAA
CTGGCGCCGCCGACCCCGAAGCCTTCGACATCGCCGGAGCCTTCGCAGCTTCGTGGAACGCCTCTGGCTGACATC
ACCGCTGTTGGAGCAAATACCCAAAACCCCGACGCCACCGTGGCTGCCTTGAAGCCGGTAAAGCCGTTTGACACC
GTCATGGAGAGGCCCATGGATATCATACTCAAACAACGCACGGCTGCCGTGCCTGTCGTCGAGGAGGCCACAGAA
CCCAAGCCTCGCATTGTGCTGACCTATCTCATTCTGAACAACTTCAAGAGCTATGCTGGTCGTCAAGAAGTTGGC
CCTTTTCACGCCTCCTTCTCATCTGTCGTTGGTCCCAATGGTTCGGGCAAGTCAAACGTTATCGATTCGCTGCTG
TTTGTCTTTGGCTTCCGAGCCAGCAAAATGCGGCAAGGAAAAATCTCTGCTCTGATCCACAACTCGGCGCATTAT
CCAAACCTGGACTTTTGCGAGGTCGAAGTTCATTTTGAAGAACCTGGCGGTGGTCACGAGGTCGTCCCCGACTCT
GCTCTCGTCATCTCGCGCAAGGCATTTCGCAACAACTCGAGCAAGTACTATATCAATGGAAAAGAGTCCAATTTT
ACCACAGTCACGACCCTTCTCCGCGAAAGAGGCGTCGACTTGGACCATAAACGCTTTCTCATTCTACAAGGAGAG
GTCGAGTCGATTGCCCAGATGAAGGCCAAGGCGGCCAACGAGCACGAGGACGGTCTGCTCGAGTATCTCGAGGAC
ATCATCGGGACGTCAAAGTACAAGACACCTATCGAAGAGGCCGCCACCGAGGTCGAAACTCTCAATGATGTCTGT
GTCGAGAAGAGCGGTCGCGTGCAGCACGTGGAAAAGGAGAAGCAAGGCCTCGAAGACAAGAAGAACAAGGCGCTT
GACTATATACGAGACGAGAACGAACTGGTCATGAAGAAGTCGAGTCTCTATCAGTTATACATCCACGAGTGCAAC
GACAACCTCTCGGTCACGCAAGAGGCCGTCACCCAAATGCAAGATCAACTCGACGAGGAGCTTGAGAAGCACCAA
GGCAGCGCGCAGATTATTGAAGAGCTGCAGAAGCAATATGCGGTCGGCAGCCAGGACTACAGCGGACAGGAGAAA
TACTCGCAGTCTTTGACGAAGCACTTGGCCAAGCTCGATCAGGAGCGCGTCAAGCTCGACGAGAAGCGCAAGTTC
CTCGAGGACAAGAAGAAGAAACTGGAAAAGACGATGAGCAACGCCGAGAAGTCGACAGCCGAGGCCGAGCAGACA
ATAGAAGCGTGCAGCCAAGACATCGAGTCCCGCACTCGCGAGGTGGCAGCTCTGGAAGAACAGGTCAAGTCAGAA
GAGGCCGAGCTTGCCAAAATTCGAGACAGCCTCAAGGGCAAGACGCAGGCATTCTCTGATAAAATTGCGGCCAAG
CTTAAGGCGCTCGAGCCCTGGACGGAAAAGATTAACCAGAAGCAGTCGGCCATAGCTGTGGCGGAGAGCGAGAGC
AACATCTTGCGCGAAAAGGCCAACGCTGGTGCTGTGGCTCTCGAGGAGCTGCAAGCCAAGATGGCGTCCATCGAG
GAAGTCAAGGCCGCCAAGGCGGAGGAGCTCAAGGAGTGCGAGACGGAGAAGCAGACGCTGCAGAAGGAGGCCGAC
AAGATGATGTCGGAACTGCAAGTTCTCTCAGAGCAGGAGCCCAAGCTCCGTTCCAAAATCTCCAGCGCTCGACAA
AAGGCCGACGAGGCCCGTTCCAGCCTGGCCAGCACGCAGACGCGAGGCAACGTCCTGGCGGCCCTCATGCGGATG
AAGGAATCGGGCCGTATCGACGGCTTTCACGGCCGGCTGGGAAACCTCGGCACCATCGACCCCAAGTACGACGTG
GCCGTCTCTACGGCTTGTCCTTCGCTGGACAATTTTGTTACTCAGACAGTCGAGGCTGGCCAGCAGTGTATTGAG
TATCTGAGGAAGAACAACCTGGGACGTGGCAACTTCATCTGTCTCGACAAGCTGAGAGCCCGAGACCTCTCGACT
ATGGAGACGCCCGAGGGAGCTCCGCGCCTGTTTGACCTGGTCAAGGCCAAGGCAGACGAGTTTCGGCCGGCTTTC
TACCACGCCATGCAGGACACTCTGGTAGCGAAGGACCTGGCCCAGGCCAACCGGATCGCGTACGGGGCCAAGAGG
TGGCGTGTCGTCACGCTCCAGGGCGAGCTCATCGACAAGTCCGGCACCATGTCCGGCGGTGGCTCGACAGTCAAG
AAGGGCCTCATGTCGTCGAAGCTCGTGGCCGACACTAGCAAGGAAGCCGTGGCCAAGCTCGAGGTCGACCTGGAC
GCGTGGGAGACCAAGTTCCGCGAGTTTCAGGAGTACCAGCGGGAGTGCGAGGGGAGGCTGAAGGAGCTGAGAGAG
CAGATTCCCCAGCTCGACACCAAGATGCAGAAGCTGGGACTCGAGGTGGAGAGCGCGACGCGGAACATGGCCGAC
GTGCAGCGGCGGATTGGCGACGTCAGCAAGGAGCATCAGCCGTCTGCCGACGACTCTCGCCGGCTGAAGACGCTA
CAGAAGGAGGTGGCCAAGCTCAACGGCGAGATCGACCAGCTGCGTGGCGAGACGGCCAGTGCCGAGGCCGAGATC
AAGACGCTGCAAGATGCCATCATGGAGGTTGGAGGCGAGCGGCTTCAGGCGCAGAGGGCCAAGGTGGACGCACTC
AAGGGCGAGACGGTCTCACACAACGAAGAGACGTCGAATGCCGAGGTCCGTCGCGCCAAGGCAGAGAAGCAGATG
GCTAAGCTGGCCAAGGACGTGGCCAAGGCATCGAGTGAGAGGGATGCAGCCGCCGACGACCTGGAGAAGCTAGAG
GTCGACATGGGCAGCCAGGGAGAGCGAGTTGAGGAGCTCAAGACGCTCGTTCAGGAGACGGAAGAGGGTCTGGTG
GCCAAGAAAGAGGAGCTGGCCGAGTTCAAGGAGGCTCTGGACGCCAAGACGGCCGAGCTGAACGAGAGTCGGGCG
GTAGAGATTGAGATGCGCAACAAGCTCGAGGAGAACCAGAAGGCGCTGGCAGAGAACGAGAAGCGTCATCGATAC
TGGAACGACAAGCTCTCCAAGCTCGTGTTGCAGAGCATCGACGATCTAACGGGGGGTGTCTCTCCCGCCAAGGCA
GCCCAGGGCGGTGAAGGCGAGATGAGGGAGGTCAAGGAAGAAGACGAGGAAGATGGGGAGAGGCAGCAGGGAGGA
GCCGACGACGACGGAGACGTGGACATGACGGACGCCCCCGACGAGGACATGACGGACCCCCCTGACGAGGATGAG
GACCAGGGCCAGCCCCAGGAGCTGCCGAGGCACACGCCGGACGAGCTCGCGGGCATGAGCAAGGAGACACTCAAG
GGCGAAATCGCGGCGCTGGAGGAGAAGACGGAAAAGGTCAATGTCGACCTCGGGGTGCTGGCAGAGTACCGACGG
CGAGTCGAGGAGCACGCAGCTCGCTCGTCCGACCTGCAGTCGGCTATCACGCAGCGCGACGCGGCCAAGAAGCGA
TGCGACGACCTCCGAAGGCTGCGGCTCGAGGGCTTCATGGCCGGCTTCGGCGCCATCTCGCTCCGGCTCAAGGAG
ATGTACCAGATGATCACGATGGGCGGAAACGCCGAGCTGGAGCTGGTCGACAGCCTGGACCCCTTTAGCGAGGGC
ATCCTCTTCAGCGTGATGCCGCCCAAGAAGAGCTGGAAGAACATTGGCAACCTGTCGGGAGGCGAGAAGACGCTG
AGCAGCCTGGCCTTGGTGTTTGCGTTGCACCACTACAAGCCGACGCCGCTGTACGTCATGGACGAGATTGACGCG
GCGCTGGACTTTAGAAACGTGTCTATTGTGGCCAACTACATCAAGGAGCGGACCAAGAACGCACAATTTGTCGTC
ATCTCGCTGCGGAACAACATGTTTGAGCTGGCGTCCAGGCTTGTGGGAGTTTACAAGGTCAACCATATGACGAGG
AACGTGACGATTGACAACCTGGACTACATCTCGCGGGACCAGCAGCAGCAGCAGCAGCCTGCGGGCCCGGGACAG
ACGACGACGCTGGCCCTGAGGTGA
Gene >Ophun1|6888
ATGTCGGAGGTCACTCCCTCCCGCCCTTCGCGTCGCGCCGCGAACAGACGGACTATCATCGACTCCGACTCCGAT
TCGAACGACACCGCCACTGCTGTCGAAGCCGAAGATGACTTCACGCCGGAGCCTGCAAGAGCCAGTCGCAGGCAG
ACGCGAGGCGGGCGTCAGTCTATGGCCCCACCTACTACCGCCGCGCCGCGTCCTCGAGGACGACCTAAGAAGGTT
TCGGCTCCAGCCGCGGAATCATCGCAGTCTGCAGACGCGACGGATCCCAACGAGACTGCACAGATAAGTCCTGAA
GATACGATGCCGAAGCTCTCTCCGCGTAAACGCAAGAGTACGGCTCCGCGACCCTCTGGCGCTGCTGTGTCTGAA
CTGGCGCCGCCGACCCCGAAGCCTTCGACATCGCCGGAGCCTTCGCAGCTTCGTGGAACGCCTCTGGCTGACATC
ACCGCTGTTGGAGCAAATACCCAAAACCCCGACGCCACCGTGGCTGCCTTGAAGCCGGTAAAGCCGTTTGACACC
GTCATGGAGAGGCCCATGGATATCATACTCAAACAACGCACGGCTGCCGTGCCTGTCGTCGAGGAGGCCACAGAA
CCCAAGCCTCGCATTGTGCTGACCTATCTCATTCTGAACAACTTCAAGAGCTATGCTGGTCGTCAAGAAGTTGGC
CCTTTTCACGCCTCCTTCTCATCTGTCGTTGGTCCCAATGGTTCGGGCAAGTCAAACGTTATCGATTCGCTGCTG
TTTGTCTTTGGCTTCCGAGCCAGCAAAATGCGGCAAGGAAAAATCTCTGCTCTGATCCACAACTCGGCGCATTAT
CCAAACCTGGACTTTTGCGAGGTCGAAGTTCATTTTGAAGAAGTTATCGATCAGGCAAGCTACTGTTCTTGATTA
ACCACCTCCTGCTCGCATTATTCTGACTCTCAGCAGCCTGGCGGTGGTCACGAGGTCGTCCCCGACTCTGCTCTC
GTCATCTCGCGCAAGGCATTTCGCAACAACTCGAGCAAGTACTATATCAATGGAAAAGAGTCCAATTTTACCACA
GTCACGACCCTTCTCCGCGAAAGAGGCGTCGACTTGGACCATAAACGCTTTCTCATTCTACAAGGAGAGGTCGAG
TCGATTGCCCAGATGAAGGCCAAGGCGGCCAACGAGCACGAGGACGGTCTGCTCGAGTATCTCGAGGACATCATC
GGGACGTCAAAGTACAAGACACCTATCGAAGAGGCCGCCACCGAGGTCGAAACTCTCAATGATGTCTGTGTCGAG
AAGAGCGGTCGCGTGCAGCACGTGGAAAAGGAGAAGCAAGGCCTCGAAGACAAGAAGAACAAGGCGCTTGACTAT
ATACGAGACGAGAACGAACTGGTCATGAAGAAGTCGAGTCTCTATCAGTTATACATCCACGAGTGCAACGACAAC
CTCTCGGTCACGCAAGAGGCCGTCACCCAAATGCAAGATCAACTCGACGAGGAGCTTGAGAAGCACCAAGGCAGC
GCGCAGATTATTGAAGAGCTGCAGAAGCAATATGCGGTCGGCAGCCAGGACTACAGCGGACAGGAGAAATACTCG
CAGTCTTTGACGAAGCACTTGGCCAAGCTCGATCAGGAGCGCGTCAAGCTCGACGAGAAGCGCAAGTTCCTCGAG
GACAAGAAGAAGAAACTGGAAAAGACGATGAGCAACGCCGAGAAGTCGACAGCCGAGGCCGAGCAGACAATAGAA
GCGTGCAGCCAAGACATCGAGTCCCGCACTCGCGAGGTGGCAGCTCTGGAAGAACAGGTCAAGTCAGAAGAGGCC
GAGCTTGCCAAAATTCGAGACAGCCTCAAGGGCAAGACGCAGGCATTCTCTGATAAAATTGCGGCCAAGCTTAAG
GCGCTCGAGCCCTGGACGGAAAAGATTAACCAGAAGCAGTCGGCCATAGCTGTGGCGGAGAGCGAGAGCAACATC
TTGCGCGAAAAGGCCAACGCTGGTGCTGTGGCTCTCGAGGAGCTGCAAGCCAAGATGGCGTCCATCGAGGAAGTC
AAGGCCGCCAAGGCGGAGGAGCTCAAGGAGTGCGAGACGGAGAAGCAGACGCTGCAGAAGGAGGCCGACAAGATG
ATGTCGGAACTGCAAGTTCTCTCAGAGCAGGAGCCCAAGCTCCGTTCCAAAATCTCCAGCGCTCGACAAAAGGCC
GACGAGGCCCGTTCCAGCCTGGCCAGCACGCAGACGCGAGGCAACGTCCTGGCGGCCCTCATGCGGATGAAGGAA
TCGGGCCGTATCGACGGCTTTCACGGCCGGCTGGGAAACCTCGGCACCATCGACCCCAAGTACGACGTGGCCGTC
TCTACGGCTTGTCCTTCGCTGGACAATTTTGTTACTCAGACAGTCGAGGCTGGCCAGCAGTGTATTGAGTATCTG
AGGAAGAACAACCTGGGACGTGGCAACTTCATCTGTCTCGACAAGCTGAGAGCCCGAGACCTCTCGACTATGGAG
ACGCCCGAGGGAGCTCCGCGCCTGTTTGACCTGGTCAAGGCCAAGGCAGACGAGTTTCGGCCGGCTTTCTACCAC
GCCATGCAGGACACTCTGGTAGCGAAGGACCTGGCCCAGGCCAACCGGATCGCGTACGGGGCCAAGAGGTGGCGT
GTCGTCACGCTCCAGGGCGAGCTCATCGACAAGTCCGGCACCATGTCCGGCGGTGGCTCGACAGTCAAGAAGGGC
CTCATGTCGTCGAAGCTCGTGGCCGACACTAGCAAGGAAGCCGTGGCCAAGCTCGAGGTCGACCTGGACGCGTGG
GAGACCAAGTTCCGCGAGTTTCAGGAGTACCAGCGGGAGTGCGAGGGGAGGCTGAAGGAGCTGAGAGAGCAGATT
CCCCAGCTCGACACCAAGATGCAGAAGCTGGGACTCGAGGTGGAGAGCGCGACGCGGAACATGGCCGACGTGCAG
CGGCGGATTGGCGACGTCAGCAAGGAGCATCAGCCGTCTGCCGACGACTCTCGCCGGCTGAAGACGCTACAGAAG
GAGGTGGCCAAGCTCAACGGCGAGATCGACCAGCTGCGTGGCGAGACGGCCAGTGCCGAGGCCGAGATCAAGACG
CTGCAAGATGCCATCATGGAGGTTGGAGGCGAGCGGCTTCAGGCGCAGAGGGCCAAGGTGGACGCACTCAAGGGC
GAGACGGTCTCACACAACGAAGAGACGTCGAATGCCGAGGTCCGTCGCGCCAAGGCAGAGAAGCAGATGGCTAAG
CTGGCCAAGGACGTGGCCAAGGCATCGAGTGAGAGGGATGCAGCCGCCGACGACCTGGAGAAGCTAGAGGTCGAC
ATGGGCAGCCAGGGAGAGCGAGTTGAGGAGCTCAAGACGCTCGTTCAGGAGACGGAAGAGGGTCTGGTGGCCAAG
AAAGAGGAGCTGGCCGAGTTCAAGGAGGCTCTGGACGCCAAGACGGCCGAGCTGAACGAGAGTCGGGCGGTAGAG
ATTGAGATGCGCAACAAGCTCGAGGAGAACCAGAAGGCGCTGGCAGAGAACGAGAAGCGTCATCGATACTGGAAC
GACAAGCTCTCCAAGCTCGTGTTGCAGAGCATCGACGATCTAACGGGGGGTGTCTCTCCCGCCAAGGCAGCCCAG
GGCGGTGAAGGCGAGATGAGGGAGGTCAAGGAAGAAGACGAGGAAGATGGGGAGAGGCAGCAGGGAGGAGCCGAC
GACGACGGAGACGTGGACATGACGGACGCCCCCGACGAGGACATGACGGACCCCCCTGACGAGGATGAGGACCAG
GGCCAGCCCCAGGAGCTGCCGAGGCACACGCCGGACGAGCTCGCGGGCATGAGCAAGGAGACACTCAAGGGCGAA
ATCGCGGCGCTGGAGGAGAAGACGGAAAAGGTCAATGTCGACCTCGGGGTGCTGGCAGAGTACCGACGGCGAGTC
GAGGAGCACGCAGCTCGCTCGTCCGACCTGCAGTCGGCTATCACGCAGCGCGACGCGGCCAAGAAGCGATGCGAC
GACCTCCGAAGGCTGCGGCTCGAGGGCTTCATGGCCGGCTTCGGCGCCATCTCGCTCCGGCTCAAGGAGATGTAC
CAGATGATCACGATGGGCGGAAACGCCGAGCTGGAGCTGGTCGACAGCCTGGACCCCTTTAGCGAGGGCATCCTC
TTCAGCGTGATGCCGCCCAAGAAGAGCTGGAAGAACATTGGCAACCTGTCGGGAGGCGAGAAGACGCTGAGCAGC
CTGGCCTTGGTGTTTGCGTTGCACCACTACAAGCCGACGCCGCTGTACGTCATGGACGAGATTGACGCGGCGCTG
GACTTTAGAAACGTGAGTGTCGTCTGTGTTTTTTTTTTGTCTGAGATGGGCTGTGCCCCTTGCTGACGACGGTTT
GTAGGTGTCTATTGTGGCCAACTACATCAAGGAGCGGACCAAGAACGCACAATTTGTCGTCATCTCGCTGCGGAA
CAACATGTTTGAGCTGGCGTCCAGGCTTGTGGGAGTTTACAAGGTCAACCATATGACGAGGAACGTGACGATTGA
CAACCTGGACTACATCTCGCGGGACCAGCAGCAGCAGCAGCAGCCTGCGGGCCCGGGACAGACGACGACGCTGGC
CCTGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail