Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6886
Gene name
LocationContig_8:10459..12025
Strand-
Gene length (bp)1566
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 5.2E-12 105 290
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-09 100 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 60 480 9.0E-96
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 60 480 9.0E-96
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 58 491 6.0E-90
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 63 502 5.0E-44
sp|Q5RCQ5|MFS11_PONAB UNC93-like protein MFSD11 OS=Pongo abelii GN=MFSD11 PE=2 SV=1 81 355 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 60 480 9.0E-96
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 60 480 9.0E-96
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 58 491 6.0E-90
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 63 502 5.0E-44
sp|Q5RCQ5|MFS11_PONAB UNC93-like protein MFSD11 OS=Pongo abelii GN=MFSD11 PE=2 SV=1 81 355 4.0E-07
sp|Q8BJ51|MFS11_MOUSE UNC93-like protein MFSD11 OS=Mus musculus GN=Mfsd11 PE=1 SV=1 81 355 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 96 118 22
3 125 142 17
4 152 174 22
5 187 209 22
6 219 241 22
7 277 299 22
8 319 341 22
9 348 370 22
10 395 417 22
11 458 480 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6886
MAPWRNRDSFPSFMAAKGPVSGIQDLHVETVNRVHVGRGGSPWEVASRAKSTLCRLRGHPWSQILLISLICFCCP
GMYNALTGLGGCGQVDATVAANATVALLSTMAVTSLFIAGPLFAWAGPRISLMAGGWTYALYSGSFLNFNRTGNG
ALVIASGAMLGVGASLLWIVQGAIMTSYVDESRKGRAIAIFWVVFNLGGGIGSLASFGLNYGSGKGTVSSSTYVA
LMIVMLFGWSLGLLLYSPERVRGTKTTAPAPKAARPWHRIIIDVARNSARVLCTWRVACMLPLFFSANVFYSYQQ
NSVNGDTFNIHTRSLNGAFYWLAQMGGGLFIGLILDLPCLGRRGRARLGWSIAFVFGLIIWGGGYQFQLWQNDRL
ARGQRQDVDFKDSALAAGPMTLYTFYGAYDALWQAFAYWLIGTESNDPTRAAILVGAYKGLQAAGGSIAWRINAF
SVSSMTELAMNWGLCIGSLLVVLPVVWTVSASSDDEGDQPERGFDEGSKGDGTQV*
Coding >Ophun1|6886
ATGGCTCCGTGGCGGAACCGCGATAGCTTCCCGTCCTTCATGGCGGCCAAAGGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGCGTGCACGTCGGTCGTGGAGGGTCGCCATGGGAGGTTGCCAGTAGAGCCAAG
TCGACGCTTTGCCGGCTTCGCGGCCATCCGTGGTCACAGATTCTGCTCATCAGCCTAATCTGCTTCTGTTGCCCC
GGGATGTACAACGCCCTCACCGGCCTCGGAGGCTGCGGCCAAGTCGACGCAACAGTAGCAGCCAACGCAACAGTA
GCCCTCCTCTCAACCATGGCCGTAACCTCTCTCTTCATAGCCGGCCCGCTCTTCGCCTGGGCCGGTCCGCGCATC
AGCCTCATGGCCGGCGGCTGGACCTACGCTCTCTACAGCGGAAGCTTCCTCAACTTCAACCGCACCGGCAACGGC
GCCCTCGTCATCGCATCGGGCGCCATGCTCGGTGTCGGCGCCTCGCTTCTATGGATCGTTCAGGGGGCCATCATG
ACCTCTTACGTCGATGAGTCGCGCAAGGGCCGCGCCATCGCCATCTTCTGGGTTGTCTTTAACCTCGGCGGCGGC
ATCGGCTCGCTCGCCTCCTTCGGCCTCAACTATGGCTCTGGCAAGGGCACCGTCTCAAGCTCAACATACGTCGCC
CTTATGATCGTCATGCTCTTCGGCTGGTCGCTAGGCCTGCTACTGTACTCGCCCGAACGCGTCCGCGGGACGAAG
ACGACGGCTCCGGCTCCGAAAGCTGCCCGGCCGTGGCACCGGATCATCATCGACGTCGCCCGGAACTCAGCCCGG
GTTCTCTGCACCTGGCGTGTCGCCTGTATGCTGCCTCTCTTCTTCTCCGCCAACGTCTTCTACAGCTACCAGCAA
AACAGCGTCAACGGCGACACCTTCAACATCCACACCCGCTCCCTCAACGGCGCCTTCTACTGGCTGGCCCAGATG
GGAGGCGGCCTGTTCATCGGCCTCATCCTCGACCTGCCCTGTCTCGGGCGTCGAGGCCGCGCTCGCCTCGGCTGG
TCCATTGCCTTTGTCTTCGGGCTCATCATCTGGGGCGGCGGATACCAGTTCCAGCTCTGGCAGAACGACCGACTC
GCTCGTGGACAGCGTCAGGACGTAGACTTCAAGGACAGCGCCCTGGCAGCGGGTCCAATGACTCTCTACACCTTC
TACGGCGCCTACGATGCCCTCTGGCAGGCTTTTGCTTACTGGCTCATCGGCACCGAGTCCAACGACCCGACCCGT
GCCGCCATCCTCGTCGGCGCCTACAAGGGCTTGCAGGCCGCGGGCGGGAGCATTGCCTGGCGCATCAATGCATTC
AGCGTGAGCTCAATGACGGAGCTGGCCATGAACTGGGGGCTCTGCATCGGCTCCCTGCTGGTCGTCCTTCCCGTT
GTCTGGACCGTTTCCGCGAGCAGCGACGACGAGGGCGATCAGCCGGAGAGGGGGTTTGATGAAGGATCAAAGGGC
GACGGCACGCAGGTGTAG
Transcript >Ophun1|6886
ATGGCTCCGTGGCGGAACCGCGATAGCTTCCCGTCCTTCATGGCGGCCAAAGGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGCGTGCACGTCGGTCGTGGAGGGTCGCCATGGGAGGTTGCCAGTAGAGCCAAG
TCGACGCTTTGCCGGCTTCGCGGCCATCCGTGGTCACAGATTCTGCTCATCAGCCTAATCTGCTTCTGTTGCCCC
GGGATGTACAACGCCCTCACCGGCCTCGGAGGCTGCGGCCAAGTCGACGCAACAGTAGCAGCCAACGCAACAGTA
GCCCTCCTCTCAACCATGGCCGTAACCTCTCTCTTCATAGCCGGCCCGCTCTTCGCCTGGGCCGGTCCGCGCATC
AGCCTCATGGCCGGCGGCTGGACCTACGCTCTCTACAGCGGAAGCTTCCTCAACTTCAACCGCACCGGCAACGGC
GCCCTCGTCATCGCATCGGGCGCCATGCTCGGTGTCGGCGCCTCGCTTCTATGGATCGTTCAGGGGGCCATCATG
ACCTCTTACGTCGATGAGTCGCGCAAGGGCCGCGCCATCGCCATCTTCTGGGTTGTCTTTAACCTCGGCGGCGGC
ATCGGCTCGCTCGCCTCCTTCGGCCTCAACTATGGCTCTGGCAAGGGCACCGTCTCAAGCTCAACATACGTCGCC
CTTATGATCGTCATGCTCTTCGGCTGGTCGCTAGGCCTGCTACTGTACTCGCCCGAACGCGTCCGCGGGACGAAG
ACGACGGCTCCGGCTCCGAAAGCTGCCCGGCCGTGGCACCGGATCATCATCGACGTCGCCCGGAACTCAGCCCGG
GTTCTCTGCACCTGGCGTGTCGCCTGTATGCTGCCTCTCTTCTTCTCCGCCAACGTCTTCTACAGCTACCAGCAA
AACAGCGTCAACGGCGACACCTTCAACATCCACACCCGCTCCCTCAACGGCGCCTTCTACTGGCTGGCCCAGATG
GGAGGCGGCCTGTTCATCGGCCTCATCCTCGACCTGCCCTGTCTCGGGCGTCGAGGCCGCGCTCGCCTCGGCTGG
TCCATTGCCTTTGTCTTCGGGCTCATCATCTGGGGCGGCGGATACCAGTTCCAGCTCTGGCAGAACGACCGACTC
GCTCGTGGACAGCGTCAGGACGTAGACTTCAAGGACAGCGCCCTGGCAGCGGGTCCAATGACTCTCTACACCTTC
TACGGCGCCTACGATGCCCTCTGGCAGGCTTTTGCTTACTGGCTCATCGGCACCGAGTCCAACGACCCGACCCGT
GCCGCCATCCTCGTCGGCGCCTACAAGGGCTTGCAGGCCGCGGGCGGGAGCATTGCCTGGCGCATCAATGCATTC
AGCGTGAGCTCAATGACGGAGCTGGCCATGAACTGGGGGCTCTGCATCGGCTCCCTGCTGGTCGTCCTTCCCGTT
GTCTGGACCGTTTCCGCGAGCAGCGACGACGAGGGCGATCAGCCGGAGAGGGGGTTTGATGAAGGATCAAAGGGC
GACGGCACGCAGGTGTAG
Gene >Ophun1|6886
ATGGCTCCGTGGCGGAACCGCGATAGCTTCCCGTCCTTCATGGCGGCCAAAGGACCCGTCTCCGGGATTCAGGAC
CTGCATGTCGAGACGGTGAACCGCGTGCACGTCGGTCGTGGAGGGTCGCCATGGGAGGTTGCCAGTAGAGCCAAG
TCGACGCTTTGCCGGCTTCGCGGCCATCCGTGGTCACAGATTCTGCTCATCAGCCTAATCTGCTTCTGTTGCCCC
GGGGTATGTATTCGACTCTCCTTGTTTCTCCCCTCATCTAACAAGCAACAGATGTACAACGCCCTCACCGGCCTC
GGAGGCTGCGGCCAAGTCGACGCAACAGTAGCAGCCAACGCAACAGTAGCCCTCCTCTCAACCATGGCCGTAACC
TCTCTCTTCATAGCCGGCCCGCTCTTCGCCTGGGCCGGTCCGCGCATCAGCCTCATGGCCGGCGGCTGGACCTAC
GCTCTCTACAGCGGAAGCTTCCTCAACTTCAACCGCACCGGCAACGGCGCCCTCGTCATCGCATCGGGCGCCATG
CTCGGTGTCGGCGCCTCGCTTCTATGGATCGTTCAGGGGGCCATCATGACCTCTTACGTCGATGAGTCGCGCAAG
GGCCGCGCCATCGCCATCTTCTGGGTTGTCTTTAACCTCGGCGGCGGCATCGGCTCGCTCGCCTCCTTCGGCCTC
AACTATGGCTCTGGCAAGGGCACCGTCTCAAGCTCAACATACGTCGCCCTTATGATCGTCATGCTCTTCGGCTGG
TCGCTAGGCCTGCTACTGTACTCGCCCGAACGCGTCCGCGGGACGAAGACGACGGCTCCGGCTCCGAAAGCTGCC
CGGCCGTGGCACCGGATCATCATCGACGTCGCCCGGAACTCAGCCCGGGTTCTCTGCACCTGGCGTGTCGCCTGT
ATGCTGCCTCTCTTCTTCTCCGCCAACGTCTTCTACAGCTACCAGCAAAACAGCGTCAACGGCGACACCTTCAAC
ATCCACACCCGCTCCCTCAACGGCGCCTTCTACTGGCTGGCCCAGATGGGAGGCGGCCTGTTCATCGGCCTCATC
CTCGACCTGCCCTGTCTCGGGCGTCGAGGCCGCGCTCGCCTCGGCTGGTCCATTGCCTTTGTCTTCGGGCTCATC
ATCTGGGGCGGCGGATACCAGTTCCAGCTCTGGCAGAACGACCGACTCGCTCGTGGACAGCGTCAGGACGTAGAC
TTCAAGGACAGCGCCCTGGCAGCGGGTCCAATGACTCTCTACACCTTCTACGGCGCCTACGATGCCCTCTGGCAG
GCTTTTGCTTACTGGCTCATCGGCACCGAGTCCAACGACCCGACCCGTGCCGCCATCCTCGTCGGCGCCTACAAG
GGCTTGCAGGCCGCGGGCGGGAGCATTGCCTGGCGCATCAATGCATTCAGCGTGAGCTCAATGACGGAGCTGGCC
ATGAACTGGGGGCTCTGCATCGGCTCCCTGCTGGTCGTCCTTCCCGTTGTCTGGACCGTTTCCGCGAGCAGCGAC
GACGAGGGCGATCAGCCGGAGAGGGGGTTTGATGAAGGATCAAAGGGCGACGGCACGCAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail