Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|688
Gene name
LocationContig_122:4335..5116
Strand+
Gene length (bp)781
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 1.5E-22 40 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YJ02|RCF1_NECH7 Respiratory supercomplex factor 1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RCF1 PE=3 SV=1 8 207 1.0E-74
sp|C9SF29|RCF1_VERA1 Respiratory supercomplex factor 1, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=RCF1 PE=3 SV=1 15 155 1.0E-53
sp|Q875C2|RCF1_PODAN Respiratory supercomplex factor 1, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RCF1 PE=3 SV=1 15 192 4.0E-52
sp|Q2GMG9|RCF1_CHAGB Respiratory supercomplex factor 1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RCF1 PE=3 SV=1 24 142 4.0E-51
sp|Q7S455|RCF1_NEUCR Respiratory supercomplex factor 1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rcf1 PE=3 SV=2 3 142 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YJ02|RCF1_NECH7 Respiratory supercomplex factor 1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RCF1 PE=3 SV=1 8 207 1.0E-74
sp|C9SF29|RCF1_VERA1 Respiratory supercomplex factor 1, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=RCF1 PE=3 SV=1 15 155 1.0E-53
sp|Q875C2|RCF1_PODAN Respiratory supercomplex factor 1, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RCF1 PE=3 SV=1 15 192 4.0E-52
sp|Q2GMG9|RCF1_CHAGB Respiratory supercomplex factor 1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RCF1 PE=3 SV=1 24 142 4.0E-51
sp|Q7S455|RCF1_NEUCR Respiratory supercomplex factor 1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rcf1 PE=3 SV=2 3 142 2.0E-49
sp|A4RI25|RCF1_MAGO7 Respiratory supercomplex factor 1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RCF1 PE=3 SV=1 17 133 5.0E-46
sp|A6SSX6|RCF1_BOTFB Respiratory supercomplex factor 1, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=rcf1 PE=3 SV=1 1 133 9.0E-43
sp|B2WBP3|RCF1_PYRTR Respiratory supercomplex factor 1, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rcf1 PE=3 SV=1 8 142 3.0E-38
sp|Q4WP59|RCF1_ASPFU Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rcf1 PE=3 SV=1 15 133 5.0E-38
sp|B0Y606|RCF1_ASPFC Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rcf1 PE=3 SV=1 15 133 5.0E-38
sp|Q0V4P1|RCF1_PHANO Respiratory supercomplex factor 1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RCF1 PE=3 SV=1 7 142 7.0E-38
sp|C5FSQ7|RCF1_ARTOC Respiratory supercomplex factor 1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RCF1 PE=3 SV=1 15 133 8.0E-38
sp|A1CXG2|RCF1_NEOFI Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rcf1 PE=3 SV=1 15 133 2.0E-37
sp|Q0CLP4|RCF1_ASPTN Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rcf1 PE=3 SV=1 15 133 2.0E-37
sp|A7F679|RCF1_SCLS1 Respiratory supercomplex factor 1, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rcf1 PE=3 SV=1 15 133 1.0E-36
sp|A1CHC5|RCF1_ASPCL Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rcf1 PE=3 SV=1 15 158 2.0E-36
sp|A2QI79|RCF1_ASPNC Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rcf1 PE=3 SV=1 15 133 4.0E-36
sp|C1G794|RCF1_PARBD Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=RCF1 PE=3 SV=1 14 133 5.0E-36
sp|C0RYW2|RCF1_PARBP Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=RCF1 PE=3 SV=1 14 133 5.0E-36
sp|Q2UGQ3|RCF1_ASPOR Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rcf1 PE=3 SV=1 15 133 9.0E-36
sp|B8N9M0|RCF1_ASPFN Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rcf1 PE=3 SV=1 15 133 9.0E-36
sp|C5P447|RCF1_COCP7 Respiratory supercomplex factor 1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RCF1 PE=3 SV=1 15 133 2.0E-35
sp|B6H465|RCF1_PENRW Respiratory supercomplex factor 1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rcf1 PE=3 SV=1 15 133 2.0E-34
sp|B6QHL8|RCF1B_TALMQ Respiratory supercomplex factor 1-B, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-B PE=3 SV=1 22 133 6.0E-34
sp|A6RBB3|RCF1_AJECN Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RCF1 PE=3 SV=1 15 133 9.0E-34
sp|C6H220|RCF1_AJECH Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=RCF1 PE=3 SV=1 15 133 9.0E-34
sp|C0NUL6|RCF1_AJECG Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RCF1 PE=3 SV=1 15 133 9.0E-34
sp|C5JIT3|RCF1_AJEDS Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=RCF1 PE=3 SV=1 15 133 1.0E-33
sp|C5GDJ2|RCF1_AJEDR Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RCF1 PE=3 SV=1 15 133 1.0E-33
sp|B6QHL9|RCF1A_TALMQ Respiratory supercomplex factor 1-A, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-A PE=3 SV=1 24 133 5.0E-32
sp|Q5B6J9|RCF1_EMENI Respiratory supercomplex factor 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rcf1 PE=3 SV=1 15 133 3.0E-31
sp|B8MJJ2|RCF1_TALSN Respiratory supercomplex factor 1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rcf1 PE=3 SV=1 21 133 6.0E-31
sp|D4DDK2|RCF1_TRIVH Respiratory supercomplex factor 1, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=RCF1 PE=3 SV=1 32 133 6.0E-29
sp|C4JHR1|RCF1_UNCRE Respiratory supercomplex factor 1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=RCF1 PE=3 SV=1 15 133 2.0E-23
sp|Q6CWT4|RCF1_KLULA Respiratory supercomplex factor 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RCF1 PE=3 SV=1 15 133 8.0E-21
sp|Q6CBQ8|RCF1_YARLI Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2 15 131 2.0E-20
sp|C4QV79|RCF1_PICPG Respiratory supercomplex factor 1, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RCF1 PE=3 SV=1 14 133 4.0E-19
sp|C4Y631|RCF1_CLAL4 Respiratory supercomplex factor 1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=RCF1 PE=3 SV=1 31 134 9.0E-19
sp|B9WHT6|RCF1_CANDC Respiratory supercomplex factor 1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RCF1 PE=3 SV=1 11 129 3.0E-18
sp|Q6BIT1|RCF1_DEBHA Respiratory supercomplex factor 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RCF1 PE=3 SV=2 15 130 1.0E-17
sp|C4YRP9|RCF1_CANAW Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain WO-1) GN=RCF1 PE=3 SV=1 11 129 1.0E-17
sp|A5DHC2|RCF1_PICGU Respiratory supercomplex factor 1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RCF1 PE=3 SV=1 31 129 9.0E-17
sp|B6K2Z6|RCF1_SCHJY Respiratory supercomplex factor 1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rcf1 PE=3 SV=1 1 111 1.0E-16
sp|Q6FSW5|RCF1_CANGA Respiratory supercomplex factor 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RCF1 PE=3 SV=1 15 131 2.0E-16
sp|C5DLZ7|RCF1_LACTC Respiratory supercomplex factor 1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RCF1 PE=3 SV=1 15 131 2.0E-16
sp|A5E2M7|RCF1_LODEL Respiratory supercomplex factor 1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RCF1 PE=3 SV=1 11 129 4.0E-16
sp|A7TFU8|RCF1_VANPO Respiratory supercomplex factor 1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RCF1 PE=3 SV=1 15 134 9.0E-16
sp|C5MAV2|RCF1_CANTT Respiratory supercomplex factor 1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RCF1 PE=3 SV=1 11 129 3.0E-15
sp|Q756G1|RCF1_ASHGO Respiratory supercomplex factor 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RCF1 PE=3 SV=1 15 131 1.0E-14
sp|Q59N74|RCF1_CANAL Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCF1 PE=3 SV=1 37 129 5.0E-14
sp|A3LVL1|RCF1_PICST Respiratory supercomplex factor 1, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RCF1 PE=3 SV=1 34 129 1.0E-13
sp|C5DWC4|RCF1_ZYGRC Respiratory supercomplex factor 1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RCF1 PE=3 SV=1 15 131 1.0E-11
sp|Q9CQJ1|HIG2A_MOUSE HIG1 domain family member 2A OS=Mus musculus GN=Higd2a PE=3 SV=1 8 91 2.0E-11
sp|Q03713|RCF1_YEAST Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF1 PE=1 SV=1 15 123 2.0E-11
sp|C8ZEH4|RCF1_YEAS8 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RCF1 PE=3 SV=1 15 123 2.0E-11
sp|A6ZM32|RCF1_YEAS7 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RCF1 PE=3 SV=1 15 123 2.0E-11
sp|C7GT60|RCF1_YEAS2 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=RCF1 PE=3 SV=1 15 123 2.0E-11
sp|B3LLM2|RCF1_YEAS1 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RCF1 PE=3 SV=1 15 123 2.0E-11
sp|A8P006|RCF1_COPC7 Respiratory supercomplex factor 1, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RCF1 PE=3 SV=1 32 131 1.0E-10
sp|Q4PIK6|RCF1_USTMA Respiratory supercomplex factor 1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RCF1 PE=3 SV=1 33 95 2.0E-10
sp|Q9BW72|HIG2A_HUMAN HIG1 domain family member 2A, mitochondrial OS=Homo sapiens GN=HIGD2A PE=1 SV=1 8 91 5.0E-10
sp|B0D4J7|RCF1_LACBS Respiratory supercomplex factor 1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RCF1 PE=3 SV=1 32 104 1.0E-08
sp|Q4VC39|HIG2B_HUMAN Putative HIG1 domain family member 2B OS=Homo sapiens GN=HIGD2B PE=5 SV=1 8 91 4.0E-08
sp|Q9JLR9|HIG1A_MOUSE HIG1 domain family member 1A, mitochondrial OS=Mus musculus GN=Higd1a PE=1 SV=1 33 91 1.0E-06
sp|Q5NVQ1|HIG1A_PONAB HIG1 domain family member 1A, mitochondrial OS=Pongo abelii GN=HIGD1A PE=3 SV=1 14 100 3.0E-06
sp|Q9Y241|HIG1A_HUMAN HIG1 domain family member 1A, mitochondrial OS=Homo sapiens GN=HIGD1A PE=1 SV=1 14 100 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 43 62 19
2 74 96 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|688
MANRSPPPPSLPGSLPSSFDDDPDFRNERRLQKIVRKLKEEPLIPLGMGLTIFAFVNAYRAIRRGDSHQANRMFR
VRVAAQGFTVLAMVAGGIFYQNDREKTKELRELQAKRAAEEKRQKWIRELEARDEEEKALVASLNRKDVPEQPSQ
PSSGGLLGKMGLWPNTDESQAADEDTSTDSGEAKPRRENPKSSLGAIGEAIASKKREESESKTGSGGKAKP*
Coding >Ophun1|688
ATGGCCAATCGATCTCCCCCTCCCCCGTCCCTCCCCGGCTCCTTACCGTCGTCCTTTGACGATGATCCAGACTTT
CGCAATGAGCGCAGACTACAAAAGATAGTACGCAAGCTCAAAGAAGAGCCCCTCATCCCACTCGGCATGGGCCTC
ACCATCTTCGCCTTCGTCAACGCCTACCGCGCCATCCGCCGCGGCGACTCGCATCAGGCAAACCGCATGTTTCGC
GTCCGCGTCGCCGCCCAGGGCTTCACCGTCCTCGCCATGGTCGCCGGCGGCATCTTCTACCAAAACGACCGCGAA
AAGACAAAGGAGCTACGAGAGCTACAGGCAAAGCGCGCCGCCGAAGAGAAGCGGCAGAAGTGGATTCGCGAGCTG
GAGGCCAGGGACGAGGAGGAAAAGGCCCTTGTCGCCAGCCTCAACCGCAAGGATGTGCCGGAACAACCGTCTCAG
CCGTCTTCGGGCGGCCTGCTTGGGAAGATGGGATTATGGCCCAACACGGATGAAAGCCAGGCTGCTGACGAGGAC
ACATCGACGGACTCCGGAGAGGCCAAGCCTAGAAGGGAGAATCCCAAGAGCTCGCTGGGGGCCATTGGCGAGGCC
ATTGCCTCGAAGAAGAGGGAAGAGAGCGAGTCCAAGACAGGTTCCGGAGGTAAAGCAAAGCCTTAG
Transcript >Ophun1|688
ATGGCCAATCGATCTCCCCCTCCCCCGTCCCTCCCCGGCTCCTTACCGTCGTCCTTTGACGATGATCCAGACTTT
CGCAATGAGCGCAGACTACAAAAGATAGTACGCAAGCTCAAAGAAGAGCCCCTCATCCCACTCGGCATGGGCCTC
ACCATCTTCGCCTTCGTCAACGCCTACCGCGCCATCCGCCGCGGCGACTCGCATCAGGCAAACCGCATGTTTCGC
GTCCGCGTCGCCGCCCAGGGCTTCACCGTCCTCGCCATGGTCGCCGGCGGCATCTTCTACCAAAACGACCGCGAA
AAGACAAAGGAGCTACGAGAGCTACAGGCAAAGCGCGCCGCCGAAGAGAAGCGGCAGAAGTGGATTCGCGAGCTG
GAGGCCAGGGACGAGGAGGAAAAGGCCCTTGTCGCCAGCCTCAACCGCAAGGATGTGCCGGAACAACCGTCTCAG
CCGTCTTCGGGCGGCCTGCTTGGGAAGATGGGATTATGGCCCAACACGGATGAAAGCCAGGCTGCTGACGAGGAC
ACATCGACGGACTCCGGAGAGGCCAAGCCTAGAAGGGAGAATCCCAAGAGCTCGCTGGGGGCCATTGGCGAGGCC
ATTGCCTCGAAGAAGAGGGAAGAGAGCGAGTCCAAGACAGGTTCCGGAGGTAAAGCAAAGCCTTAG
Gene >Ophun1|688
ATGGCCAATCGATCTCCCCCTCCCCCGTCCCTCCCCGGCTCCTTACCGTCGTCCTTTGACGATGATCCGTACGTG
CCTCCACGAAACCTCCCACAGCTTGAATCTCGAGCTCACTCGGCTCTCTCATCATCAGAGACTTTCGCAATGAGC
GCAGACTACAAAAGATAGTACGCAAGCTCAAAGAAGAGCCCCTCATCCCACTCGGTACGCCCCTTCTTGATCCCT
CGTCCCATCCCAGCTCACCAGACTCTCAGGCATGGGCCTCACCATCTTCGCCTTCGTCAACGCCTACCGCGCCAT
CCGCCGCGGCGACTCGCATCAGGCAAACCGCATGTTTCGCGTCCGCGTCGCCGCCCAGGGCTTCACCGTCCTCGC
CATGGTCGCCGGCGGCATCTTCTACCAAAACGACCGCGAAAAGACAAAGGAGCTACGAGAGCTACAGGCAAAGCG
CGCCGCCGAAGAGAAGCGGCAGAAGTGGATTCGCGAGCTGGAGGCCAGGGACGAGGAGGAAAAGGCCCTTGTCGC
CAGCCTCAACCGCAAGGATGTGCCGGAACAACCGTCTCAGCCGTCTTCGGGCGGCCTGCTTGGGAAGATGGGATT
ATGGCCCAACACGGATGAAAGCCAGGCTGCTGACGAGGACACATCGACGGACTCCGGAGAGGCCAAGCCTAGAAG
GGAGAATCCCAAGAGCTCGCTGGGGGCCATTGGCGAGGCCATTGCCTCGAAGAAGAGGGAAGAGAGCGAGTCCAA
GACAGGTTCCGGAGGTAAAGCAAAGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail