Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6870
Gene name
LocationContig_794:2716..6986
Strand-
Gene length (bp)4270
Transcript length (bp)4221
Coding sequence length (bp)4221
Protein length (aa) 1407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 0.0E+00 6 1344

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1252 2.0E-68
sp|Q04183|TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS120 PE=1 SV=1 332 1226 7.0E-24
sp|Q0JBY9|TR120_ORYSJ Trafficking protein particle complex II-specific subunit 120 homolog OS=Oryza sativa subsp. japonica GN=TRS120 PE=2 SV=1 792 975 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6870
MSLDPLLPIAPARVSLLLVPLGRLRAANFASYVERLRTEQVVYLRDVSADGRPNRNMFSPLAFPDGAILYHLITH
MPPPSHLALSPFDLYREPLVVIALADGEELRNAAFIPTDSPAAASIFDSNVVALHEELEKLRDVYPKALVHRAVI
FDYTPSEKDAPLPDGIVSVPPVQDCKRTTLKTIMCDVSSLLLAEMTTLAKSFEGMAAIQSPGQINSVSKHVVEGS
NSGPGLGSGVVRRNSHFTVSQQDVRPSSATGLDSARQARMSMPPMASPRPPINSSSSLPARPTTPTKGSLPSIPM
SPDDGQLELSPGASRGDDRVSVQGFGNGSPNDRWRLRGKGRTSVVVGSLFLQGGRWSDSLRELCDAASTARSLND
HVWHGKALELIVLNLLLLAWSGMGFQVPMVCLPPQEQRSTNAPPIIKIDKESDAVAAEKQPLHLRQLQALLPELL
DRIAGLYSKVSSESLPPLPQAEAIIRFSKILLAMHICGGRLDAKALDMMIRGTPHEQRLTTSPRLGLVPTRQTIV
GLLFRAFPSSATELLTTTDRASVLCGMASVLGSLGYHRKRAMVMRELVSVLIGGLVEARTRGAADAGVHPAAGLV
SLTSGHDGTNGAVALDLAETDAEHGLEALLENLCRSYGILGFGGEEDSDEAAVARILDQSWARSFGLPGVKLNIL
RACINFSEALPDFHGVLKFSTDLLRAGGSGIAPGPRREDAAPLIHKDEQVRLATNVSRTAALVQRLGMGHLMAEY
WDEFLVRGIALEPLSEARTPVPHARGDLPGASVEVSSQGVNPFIYNPFLKEADEVAEQHLVAGETATFRVTLQNT
YDVDVDIESVRLCSEGVELESWPERLTLGPYRTQLVRIRGRPREPGSVRLTGAMVKVCGCRERRFPIFAKAWKPP
TQDKIKVRGTSALETRRTSNEAAPETKTVSFNVIAAQPLLVVKSTTLPQSAVMILEGERQTFSVTMRNASDVPVD
LMLFSFKDATQAPLQEALGRRDATPAELYEYEFILSKRRALQLVDADENQKRGIAANGEATFDFEILGKPGLTTA
TIQVDYTFLGVARDEVTADRFFTRRVSVDLRVTVNASVELTRVDALSIEGRVPALVWERLGQGVPEGAEDDEYCL
LCMDLRNAWPSLMAVRLEGEDGLAVEENVLPGKTSRFVLPVKSIYMEGAHEPIPSLDPSRGRQFVVSTSKLSPDM
ERANREAFWYRERLLERVRATWRTTSSVPRRNGAVELRNMRLTPRMLEAMRIDEVAFEVTVEGGQSTGEGRATAF
VDDFLTMTVRVTNRTASTMYPLLRLLPALCHRPTMVALDHTRKLAWNGTLQQLLPAMPAHGSTSFSMGMTALCRG
EFELGASVEEVRTQEEETTREEGRRKSLVDAALGVRQRRMWHSRRPFVLSVRDRDE*
Coding >Ophun1|6870
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCCAGAGTCAGCCTCCTGCTCGTCCCGCTCGGGAGGCTCAGG
GCCGCCAACTTTGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTAGCGCTGAT
GGCCGTCCGAATAGGAATATGTTTTCGCCGCTGGCGTTTCCTGATGGTGCTATCCTCTACCATCTTATCACCCAT
ATGCCGCCGCCGTCACATCTTGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCT
GACGGTGAGGAGCTACGGAATGCCGCCTTCATACCGACAGACTCGCCAGCTGCCGCGTCCATCTTCGACAGCAAC
GTCGTCGCCCTACACGAGGAGCTCGAGAAGCTGCGCGACGTCTATCCCAAGGCTCTCGTTCACCGCGCCGTCATA
TTCGACTATACACCTTCCGAAAAGGACGCGCCTTTACCCGACGGCATCGTCTCCGTTCCGCCTGTTCAAGATTGC
AAGCGCACGACGCTCAAGACGATCATGTGTGACGTCTCTTCGCTACTCCTGGCCGAGATGACGACGCTGGCCAAG
TCGTTTGAGGGAATGGCTGCCATTCAGTCGCCAGGACAAATCAATTCTGTCTCGAAGCACGTTGTCGAGGGGTCT
AATTCGGGGCCGGGGTTGGGCAGCGGCGTTGTTCGGAGGAACTCGCACTTTACCGTTTCGCAACAGGATGTGCGT
CCCAGCTCTGCTACCGGCTTGGACAGCGCCCGTCAGGCTCGCATGTCGATGCCCCCAATGGCTTCGCCCAGACCC
CCAATCAACTCCAGCAGTTCTCTGCCGGCGAGACCCACGACGCCGACCAAGGGAAGCCTACCGAGCATCCCGATG
AGTCCCGATGACGGACAGCTCGAATTGAGTCCCGGAGCGAGTCGTGGAGACGATCGCGTATCCGTCCAGGGCTTT
GGCAACGGCAGTCCCAACGATCGCTGGCGGCTACGGGGCAAGGGACGCACCTCGGTTGTCGTCGGCTCCCTATTT
CTACAGGGCGGCCGCTGGAGCGACTCGCTCAGGGAGCTATGTGATGCTGCCTCGACCGCGCGCTCGCTCAACGAC
CATGTCTGGCACGGCAAGGCGCTCGAGCTCATCGTCTTGAATCTCCTCCTACTGGCCTGGTCCGGCATGGGCTTC
CAGGTGCCCATGGTCTGCCTACCCCCTCAGGAGCAGCGGTCAACCAACGCACCTCCAATCATCAAGATAGACAAG
GAGAGCGACGCAGTTGCAGCTGAGAAGCAGCCTCTACACCTGAGACAGCTGCAAGCTCTTCTCCCGGAGCTGCTG
GACCGCATCGCCGGCCTGTACTCCAAGGTGTCGTCGGAGAGTCTACCGCCGCTGCCTCAGGCCGAAGCCATCATC
AGGTTCTCCAAGATTCTGCTGGCGATGCATATCTGCGGCGGGAGGCTGGACGCAAAGGCACTCGACATGATGATC
CGCGGGACGCCGCACGAGCAGCGGCTGACGACGTCTCCGAGGCTCGGACTCGTACCCACGCGACAGACCATCGTC
GGCCTGCTGTTTAGGGCTTTTCCCTCGTCGGCGACGGAGCTTCTCACCACGACGGACCGCGCATCTGTTCTATGC
GGCATGGCTTCGGTGCTCGGCTCGTTGGGGTACCATCGCAAGAGAGCCATGGTGATGCGCGAGCTGGTCTCGGTT
CTGATCGGGGGCCTCGTCGAAGCCCGGACGCGGGGCGCAGCTGATGCCGGTGTCCATCCTGCTGCCGGTCTCGTG
TCACTGACTTCGGGCCACGACGGGACAAACGGCGCCGTGGCCCTGGATCTTGCAGAGACGGACGCGGAGCACGGG
CTGGAGGCGCTGCTGGAGAATCTTTGTCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGAAGATTCTGATGAG
GCGGCTGTTGCTCGCATCCTTGACCAGTCGTGGGCTCGGTCTTTTGGTCTTCCAGGCGTCAAGCTCAATATTCTC
CGCGCGTGTATCAACTTCTCCGAAGCACTGCCGGACTTTCACGGTGTACTCAAGTTCTCGACCGATCTCCTCCGA
GCCGGGGGCTCAGGCATTGCTCCCGGCCCGCGGCGGGAAGACGCGGCGCCCCTGATTCACAAGGACGAACAGGTC
CGGCTGGCGACCAACGTCTCCCGGACGGCGGCACTGGTGCAGAGGCTGGGCATGGGTCACCTCATGGCCGAGTAC
TGGGACGAGTTCCTGGTTCGGGGCATCGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGCCACACGCTCGC
GGCGATCTTCCAGGCGCTTCGGTTGAGGTTTCGTCTCAGGGTGTGAATCCCTTCATCTACAACCCGTTTCTCAAG
GAGGCAGATGAGGTCGCTGAGCAGCATCTGGTGGCGGGTGAGACGGCTACGTTTAGAGTCACGCTGCAGAACACG
TACGACGTCGATGTCGACATCGAGAGCGTCCGCCTCTGCAGTGAAGGCGTCGAACTCGAGTCGTGGCCGGAGCGG
CTGACGCTCGGCCCGTACAGGACGCAGCTGGTGCGCATCCGGGGACGGCCACGGGAGCCAGGCTCCGTTCGGCTC
ACGGGAGCCATGGTCAAGGTCTGCGGATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAGCCGCCG
ACGCAGGACAAGATCAAGGTCCGTGGCACGTCGGCGCTGGAGACGAGGAGGACGTCGAATGAGGCGGCTCCGGAG
ACCAAGACGGTGAGCTTCAACGTCATTGCCGCTCAGCCGCTGCTGGTGGTGAAGTCGACGACGCTTCCGCAGTCG
GCCGTCATGATTCTCGAGGGAGAGAGGCAGACGTTTTCCGTCACGATGCGCAATGCTTCGGACGTGCCCGTCGAT
CTGATGCTCTTCTCCTTCAAAGATGCGACGCAGGCGCCGCTTCAAGAGGCCCTCGGCAGACGAGACGCCACTCCG
GCCGAACTCTACGAGTACGAGTTCATCCTCAGCAAGAGACGGGCGCTGCAGCTCGTCGACGCTGATGAGAACCAG
AAGCGCGGCATCGCGGCCAATGGCGAGGCTACCTTTGACTTTGAGATTCTCGGCAAGCCCGGTCTGACGACGGCG
ACGATTCAGGTTGACTACACGTTCCTGGGCGTGGCGCGGGATGAGGTTACGGCGGATCGATTCTTTACTCGGCGC
GTCTCGGTCGATCTACGGGTGACGGTCAATGCCAGCGTCGAGCTGACGCGGGTTGACGCGCTGTCGATCGAGGGG
CGGGTTCCGGCGCTCGTGTGGGAGAGGCTGGGTCAGGGCGTGCCGGAGGGGGCTGAAGATGACGAGTACTGCCTG
CTGTGCATGGATCTGCGCAACGCGTGGCCGAGTCTCATGGCCGTCCGGCTCGAGGGCGAAGACGGGCTGGCGGTG
GAGGAGAATGTGCTGCCGGGCAAGACGAGCAGGTTCGTGCTACCGGTCAAGAGCATCTACATGGAGGGTGCGCAC
GAGCCCATCCCGAGCTTGGATCCGTCACGGGGTCGACAGTTCGTCGTCAGCACCAGCAAGCTATCGCCGGACATG
GAGCGGGCCAACCGCGAGGCGTTCTGGTACCGCGAGAGGTTGCTGGAGCGGGTGCGGGCCACGTGGCGAACGACG
TCGTCGGTGCCGAGACGGAACGGGGCCGTGGAGCTGCGGAACATGCGGCTGACGCCCCGGATGCTGGAGGCGATG
CGCATCGACGAGGTGGCCTTTGAGGTGACGGTCGAGGGCGGACAGTCGACGGGAGAAGGCAGGGCGACGGCCTTT
GTCGACGACTTCCTGACGATGACGGTACGCGTGACGAACCGGACGGCGTCGACCATGTATCCCTTGCTCCGGCTG
CTACCGGCGCTGTGCCACCGACCGACCATGGTGGCGCTGGACCACACGCGCAAGCTGGCCTGGAACGGGACGCTG
CAGCAGCTGCTACCAGCCATGCCAGCGCACGGGTCGACGAGCTTCAGCATGGGGATGACGGCGCTGTGTCGGGGG
GAGTTTGAGCTGGGCGCTTCGGTCGAGGAGGTTCGGACGCAGGAGGAGGAGACGACGAGGGAGGAGGGGAGGAGG
AAGAGCCTGGTGGATGCGGCGCTGGGGGTGAGGCAGCGGAGGATGTGGCATTCGAGGAGGCCTTTTGTGTTGTCG
GTGAGGGATCGGGATGAGTAG
Transcript >Ophun1|6870
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCCAGAGTCAGCCTCCTGCTCGTCCCGCTCGGGAGGCTCAGG
GCCGCCAACTTTGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTAGCGCTGAT
GGCCGTCCGAATAGGAATATGTTTTCGCCGCTGGCGTTTCCTGATGGTGCTATCCTCTACCATCTTATCACCCAT
ATGCCGCCGCCGTCACATCTTGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCT
GACGGTGAGGAGCTACGGAATGCCGCCTTCATACCGACAGACTCGCCAGCTGCCGCGTCCATCTTCGACAGCAAC
GTCGTCGCCCTACACGAGGAGCTCGAGAAGCTGCGCGACGTCTATCCCAAGGCTCTCGTTCACCGCGCCGTCATA
TTCGACTATACACCTTCCGAAAAGGACGCGCCTTTACCCGACGGCATCGTCTCCGTTCCGCCTGTTCAAGATTGC
AAGCGCACGACGCTCAAGACGATCATGTGTGACGTCTCTTCGCTACTCCTGGCCGAGATGACGACGCTGGCCAAG
TCGTTTGAGGGAATGGCTGCCATTCAGTCGCCAGGACAAATCAATTCTGTCTCGAAGCACGTTGTCGAGGGGTCT
AATTCGGGGCCGGGGTTGGGCAGCGGCGTTGTTCGGAGGAACTCGCACTTTACCGTTTCGCAACAGGATGTGCGT
CCCAGCTCTGCTACCGGCTTGGACAGCGCCCGTCAGGCTCGCATGTCGATGCCCCCAATGGCTTCGCCCAGACCC
CCAATCAACTCCAGCAGTTCTCTGCCGGCGAGACCCACGACGCCGACCAAGGGAAGCCTACCGAGCATCCCGATG
AGTCCCGATGACGGACAGCTCGAATTGAGTCCCGGAGCGAGTCGTGGAGACGATCGCGTATCCGTCCAGGGCTTT
GGCAACGGCAGTCCCAACGATCGCTGGCGGCTACGGGGCAAGGGACGCACCTCGGTTGTCGTCGGCTCCCTATTT
CTACAGGGCGGCCGCTGGAGCGACTCGCTCAGGGAGCTATGTGATGCTGCCTCGACCGCGCGCTCGCTCAACGAC
CATGTCTGGCACGGCAAGGCGCTCGAGCTCATCGTCTTGAATCTCCTCCTACTGGCCTGGTCCGGCATGGGCTTC
CAGGTGCCCATGGTCTGCCTACCCCCTCAGGAGCAGCGGTCAACCAACGCACCTCCAATCATCAAGATAGACAAG
GAGAGCGACGCAGTTGCAGCTGAGAAGCAGCCTCTACACCTGAGACAGCTGCAAGCTCTTCTCCCGGAGCTGCTG
GACCGCATCGCCGGCCTGTACTCCAAGGTGTCGTCGGAGAGTCTACCGCCGCTGCCTCAGGCCGAAGCCATCATC
AGGTTCTCCAAGATTCTGCTGGCGATGCATATCTGCGGCGGGAGGCTGGACGCAAAGGCACTCGACATGATGATC
CGCGGGACGCCGCACGAGCAGCGGCTGACGACGTCTCCGAGGCTCGGACTCGTACCCACGCGACAGACCATCGTC
GGCCTGCTGTTTAGGGCTTTTCCCTCGTCGGCGACGGAGCTTCTCACCACGACGGACCGCGCATCTGTTCTATGC
GGCATGGCTTCGGTGCTCGGCTCGTTGGGGTACCATCGCAAGAGAGCCATGGTGATGCGCGAGCTGGTCTCGGTT
CTGATCGGGGGCCTCGTCGAAGCCCGGACGCGGGGCGCAGCTGATGCCGGTGTCCATCCTGCTGCCGGTCTCGTG
TCACTGACTTCGGGCCACGACGGGACAAACGGCGCCGTGGCCCTGGATCTTGCAGAGACGGACGCGGAGCACGGG
CTGGAGGCGCTGCTGGAGAATCTTTGTCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGAAGATTCTGATGAG
GCGGCTGTTGCTCGCATCCTTGACCAGTCGTGGGCTCGGTCTTTTGGTCTTCCAGGCGTCAAGCTCAATATTCTC
CGCGCGTGTATCAACTTCTCCGAAGCACTGCCGGACTTTCACGGTGTACTCAAGTTCTCGACCGATCTCCTCCGA
GCCGGGGGCTCAGGCATTGCTCCCGGCCCGCGGCGGGAAGACGCGGCGCCCCTGATTCACAAGGACGAACAGGTC
CGGCTGGCGACCAACGTCTCCCGGACGGCGGCACTGGTGCAGAGGCTGGGCATGGGTCACCTCATGGCCGAGTAC
TGGGACGAGTTCCTGGTTCGGGGCATCGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGCCACACGCTCGC
GGCGATCTTCCAGGCGCTTCGGTTGAGGTTTCGTCTCAGGGTGTGAATCCCTTCATCTACAACCCGTTTCTCAAG
GAGGCAGATGAGGTCGCTGAGCAGCATCTGGTGGCGGGTGAGACGGCTACGTTTAGAGTCACGCTGCAGAACACG
TACGACGTCGATGTCGACATCGAGAGCGTCCGCCTCTGCAGTGAAGGCGTCGAACTCGAGTCGTGGCCGGAGCGG
CTGACGCTCGGCCCGTACAGGACGCAGCTGGTGCGCATCCGGGGACGGCCACGGGAGCCAGGCTCCGTTCGGCTC
ACGGGAGCCATGGTCAAGGTCTGCGGATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAGCCGCCG
ACGCAGGACAAGATCAAGGTCCGTGGCACGTCGGCGCTGGAGACGAGGAGGACGTCGAATGAGGCGGCTCCGGAG
ACCAAGACGGTGAGCTTCAACGTCATTGCCGCTCAGCCGCTGCTGGTGGTGAAGTCGACGACGCTTCCGCAGTCG
GCCGTCATGATTCTCGAGGGAGAGAGGCAGACGTTTTCCGTCACGATGCGCAATGCTTCGGACGTGCCCGTCGAT
CTGATGCTCTTCTCCTTCAAAGATGCGACGCAGGCGCCGCTTCAAGAGGCCCTCGGCAGACGAGACGCCACTCCG
GCCGAACTCTACGAGTACGAGTTCATCCTCAGCAAGAGACGGGCGCTGCAGCTCGTCGACGCTGATGAGAACCAG
AAGCGCGGCATCGCGGCCAATGGCGAGGCTACCTTTGACTTTGAGATTCTCGGCAAGCCCGGTCTGACGACGGCG
ACGATTCAGGTTGACTACACGTTCCTGGGCGTGGCGCGGGATGAGGTTACGGCGGATCGATTCTTTACTCGGCGC
GTCTCGGTCGATCTACGGGTGACGGTCAATGCCAGCGTCGAGCTGACGCGGGTTGACGCGCTGTCGATCGAGGGG
CGGGTTCCGGCGCTCGTGTGGGAGAGGCTGGGTCAGGGCGTGCCGGAGGGGGCTGAAGATGACGAGTACTGCCTG
CTGTGCATGGATCTGCGCAACGCGTGGCCGAGTCTCATGGCCGTCCGGCTCGAGGGCGAAGACGGGCTGGCGGTG
GAGGAGAATGTGCTGCCGGGCAAGACGAGCAGGTTCGTGCTACCGGTCAAGAGCATCTACATGGAGGGTGCGCAC
GAGCCCATCCCGAGCTTGGATCCGTCACGGGGTCGACAGTTCGTCGTCAGCACCAGCAAGCTATCGCCGGACATG
GAGCGGGCCAACCGCGAGGCGTTCTGGTACCGCGAGAGGTTGCTGGAGCGGGTGCGGGCCACGTGGCGAACGACG
TCGTCGGTGCCGAGACGGAACGGGGCCGTGGAGCTGCGGAACATGCGGCTGACGCCCCGGATGCTGGAGGCGATG
CGCATCGACGAGGTGGCCTTTGAGGTGACGGTCGAGGGCGGACAGTCGACGGGAGAAGGCAGGGCGACGGCCTTT
GTCGACGACTTCCTGACGATGACGGTACGCGTGACGAACCGGACGGCGTCGACCATGTATCCCTTGCTCCGGCTG
CTACCGGCGCTGTGCCACCGACCGACCATGGTGGCGCTGGACCACACGCGCAAGCTGGCCTGGAACGGGACGCTG
CAGCAGCTGCTACCAGCCATGCCAGCGCACGGGTCGACGAGCTTCAGCATGGGGATGACGGCGCTGTGTCGGGGG
GAGTTTGAGCTGGGCGCTTCGGTCGAGGAGGTTCGGACGCAGGAGGAGGAGACGACGAGGGAGGAGGGGAGGAGG
AAGAGCCTGGTGGATGCGGCGCTGGGGGTGAGGCAGCGGAGGATGTGGCATTCGAGGAGGCCTTTTGTGTTGTCG
GTGAGGGATCGGGATGAGTAG
Gene >Ophun1|6870
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCCAGAGTCAGCCTCCTGCTCGTCCCGCTCGGGAGGCTCAGG
GCCGCCAACTTTGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTAGCGCTGAT
GGCCGTCCGAATAGGAGTGAGTTCTTCGTGAGAGATCAGGAACGGAGAGAGCTGACTTGTTCTAGATATGTTTTC
GCCGCTGGCGTTTCCTGATGGTGCTATCCTCTACCATCTTATCACCCATATGCCGCCGCCGTCACATCTTGCCCT
CTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCTGACGGTGAGGAGCTACGGAATGCCGC
CTTCATACCGACAGACTCGCCAGCTGCCGCGTCCATCTTCGACAGCAACGTCGTCGCCCTACACGAGGAGCTCGA
GAAGCTGCGCGACGTCTATCCCAAGGCTCTCGTTCACCGCGCCGTCATATTCGACTATACACCTTCCGAAAAGGA
CGCGCCTTTACCCGACGGCATCGTCTCCGTTCCGCCTGTTCAAGATTGCAAGCGCACGACGCTCAAGACGATCAT
GTGTGACGTCTCTTCGCTACTCCTGGCCGAGATGACGACGCTGGCCAAGTCGTTTGAGGGAATGGCTGCCATTCA
GTCGCCAGGACAAATCAATTCTGTCTCGAAGCACGTTGTCGAGGGGTCTAATTCGGGGCCGGGGTTGGGCAGCGG
CGTTGTTCGGAGGAACTCGCACTTTACCGTTTCGCAACAGGATGTGCGTCCCAGCTCTGCTACCGGCTTGGACAG
CGCCCGTCAGGCTCGCATGTCGATGCCCCCAATGGCTTCGCCCAGACCCCCAATCAACTCCAGCAGTTCTCTGCC
GGCGAGACCCACGACGCCGACCAAGGGAAGCCTACCGAGCATCCCGATGAGTCCCGATGACGGACAGCTCGAATT
GAGTCCCGGAGCGAGTCGTGGAGACGATCGCGTATCCGTCCAGGGCTTTGGCAACGGCAGTCCCAACGATCGCTG
GCGGCTACGGGGCAAGGGACGCACCTCGGTTGTCGTCGGCTCCCTATTTCTACAGGGCGGCCGCTGGAGCGACTC
GCTCAGGGAGCTATGTGATGCTGCCTCGACCGCGCGCTCGCTCAACGACCATGTCTGGCACGGCAAGGCGCTCGA
GCTCATCGTCTTGAATCTCCTCCTACTGGCCTGGTCCGGCATGGGCTTCCAGGTGCCCATGGTCTGCCTACCCCC
TCAGGAGCAGCGGTCAACCAACGCACCTCCAATCATCAAGATAGACAAGGAGAGCGACGCAGTTGCAGCTGAGAA
GCAGCCTCTACACCTGAGACAGCTGCAAGCTCTTCTCCCGGAGCTGCTGGACCGCATCGCCGGCCTGTACTCCAA
GGTGTCGTCGGAGAGTCTACCGCCGCTGCCTCAGGCCGAAGCCATCATCAGGTTCTCCAAGATTCTGCTGGCGAT
GCATATCTGCGGCGGGAGGCTGGACGCAAAGGCACTCGACATGATGATCCGCGGGACGCCGCACGAGCAGCGGCT
GACGACGTCTCCGAGGCTCGGACTCGTACCCACGCGACAGACCATCGTCGGCCTGCTGTTTAGGGCTTTTCCCTC
GTCGGCGACGGAGCTTCTCACCACGACGGACCGCGCATCTGTTCTATGCGGCATGGCTTCGGTGCTCGGCTCGTT
GGGGTACCATCGCAAGAGAGCCATGGTGATGCGCGAGCTGGTCTCGGTTCTGATCGGGGGCCTCGTCGAAGCCCG
GACGCGGGGCGCAGCTGATGCCGGTGTCCATCCTGCTGCCGGTCTCGTGTCACTGACTTCGGGCCACGACGGGAC
AAACGGCGCCGTGGCCCTGGATCTTGCAGAGACGGACGCGGAGCACGGGCTGGAGGCGCTGCTGGAGAATCTTTG
TCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGAAGATTCTGATGAGGCGGCTGTTGCTCGCATCCTTGACCA
GTCGTGGGCTCGGTCTTTTGGTCTTCCAGGCGTCAAGCTCAATATTCTCCGCGCGTGTATCAACTTCTCCGAAGC
ACTGCCGGACTTTCACGGTGTACTCAAGTTCTCGACCGATCTCCTCCGAGCCGGGGGCTCAGGCATTGCTCCCGG
CCCGCGGCGGGAAGACGCGGCGCCCCTGATTCACAAGGACGAACAGGTCCGGCTGGCGACCAACGTCTCCCGGAC
GGCGGCACTGGTGCAGAGGCTGGGCATGGGTCACCTCATGGCCGAGTACTGGGACGAGTTCCTGGTTCGGGGCAT
CGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGCCACACGCTCGCGGCGATCTTCCAGGCGCTTCGGTTGA
GGTTTCGTCTCAGGGTGTGAATCCCTTCATCTACAACCCGTTTCTCAAGGAGGCAGATGAGGTCGCTGAGCAGCA
TCTGGTGGCGGGTGAGACGGCTACGTTTAGAGTCACGCTGCAGAACACGTACGACGTCGATGTCGACATCGAGAG
CGTCCGCCTCTGCAGTGAAGGCGTCGAACTCGAGTCGTGGCCGGAGCGGCTGACGCTCGGCCCGTACAGGACGCA
GCTGGTGCGCATCCGGGGACGGCCACGGGAGCCAGGCTCCGTTCGGCTCACGGGAGCCATGGTCAAGGTCTGCGG
ATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAGCCGCCGACGCAGGACAAGATCAAGGTCCGTGG
CACGTCGGCGCTGGAGACGAGGAGGACGTCGAATGAGGCGGCTCCGGAGACCAAGACGGTGAGCTTCAACGTCAT
TGCCGCTCAGCCGCTGCTGGTGGTGAAGTCGACGACGCTTCCGCAGTCGGCCGTCATGATTCTCGAGGGAGAGAG
GCAGACGTTTTCCGTCACGATGCGCAATGCTTCGGACGTGCCCGTCGATCTGATGCTCTTCTCCTTCAAAGATGC
GACGCAGGCGCCGCTTCAAGAGGCCCTCGGCAGACGAGACGCCACTCCGGCCGAACTCTACGAGTACGAGTTCAT
CCTCAGCAAGAGACGGGCGCTGCAGCTCGTCGACGCTGATGAGAACCAGAAGCGCGGCATCGCGGCCAATGGCGA
GGCTACCTTTGACTTTGAGATTCTCGGCAAGCCCGGTCTGACGACGGCGACGATTCAGGTTGACTACACGTTCCT
GGGCGTGGCGCGGGATGAGGTTACGGCGGATCGATTCTTTACTCGGCGCGTCTCGGTCGATCTACGGGTGACGGT
CAATGCCAGCGTCGAGCTGACGCGGGTTGACGCGCTGTCGATCGAGGGGCGGGTTCCGGCGCTCGTGTGGGAGAG
GCTGGGTCAGGGCGTGCCGGAGGGGGCTGAAGATGACGAGTACTGCCTGCTGTGCATGGATCTGCGCAACGCGTG
GCCGAGTCTCATGGCCGTCCGGCTCGAGGGCGAAGACGGGCTGGCGGTGGAGGAGAATGTGCTGCCGGGCAAGAC
GAGCAGGTTCGTGCTACCGGTCAAGAGCATCTACATGGAGGGTGCGCACGAGCCCATCCCGAGCTTGGATCCGTC
ACGGGGTCGACAGTTCGTCGTCAGCACCAGCAAGCTATCGCCGGACATGGAGCGGGCCAACCGCGAGGCGTTCTG
GTACCGCGAGAGGTTGCTGGAGCGGGTGCGGGCCACGTGGCGAACGACGTCGTCGGTGCCGAGACGGAACGGGGC
CGTGGAGCTGCGGAACATGCGGCTGACGCCCCGGATGCTGGAGGCGATGCGCATCGACGAGGTGGCCTTTGAGGT
GACGGTCGAGGGCGGACAGTCGACGGGAGAAGGCAGGGCGACGGCCTTTGTCGACGACTTCCTGACGATGACGGT
ACGCGTGACGAACCGGACGGCGTCGACCATGTATCCCTTGCTCCGGCTGCTACCGGCGCTGTGCCACCGACCGAC
CATGGTGGCGCTGGACCACACGCGCAAGCTGGCCTGGAACGGGACGCTGCAGCAGCTGCTACCAGCCATGCCAGC
GCACGGGTCGACGAGCTTCAGCATGGGGATGACGGCGCTGTGTCGGGGGGAGTTTGAGCTGGGCGCTTCGGTCGA
GGAGGTTCGGACGCAGGAGGAGGAGACGACGAGGGAGGAGGGGAGGAGGAAGAGCCTGGTGGATGCGGCGCTGGG
GGTGAGGCAGCGGAGGATGTGGCATTCGAGGAGGCCTTTTGTGTTGTCGGTGAGGGATCGGGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail