Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|687
Gene name
LocationContig_122:1099..3841
Strand-
Gene length (bp)2742
Transcript length (bp)2742
Coding sequence length (bp)2742
Protein length (aa) 914

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 1.3E-09 137 172
PF13202 EF-hand_5 EF hand 2.6E-03 282 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 256 358 1.0E-09
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 253 358 4.0E-09
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 133 184 3.0E-08
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 255 358 3.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 136 188 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 256 358 1.0E-09
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 253 358 4.0E-09
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 133 184 3.0E-08
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 255 358 3.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 136 188 6.0E-08
sp|P14199|REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster GN=ref(2)P PE=1 SV=2 133 184 4.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 136 188 4.0E-07
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 208 366 5.0E-07
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 256 358 6.0E-07
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 277 342 8.0E-07
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 277 342 1.0E-06
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 282 350 3.0E-06
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 216 343 3.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 134 188 3.0E-06
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 284 342 4.0E-06
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 284 342 4.0E-06
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 284 342 4.0E-06
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 284 342 4.0E-06
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 284 342 4.0E-06
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 284 342 4.0E-06
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 134 196 5.0E-06
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 211 344 6.0E-06
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 282 350 7.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 134 188 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|687
MWLSTPSVETLTRPRLAVALVSTVAAVSACYLVFQSSWSTGFRDRTGITGALHRSNAVRRSRRRDTNGSSSSSDA
GGDENVQADHLAAEVETVVDVGADEWWNDLAGFQPSQRAGHNIVSLLFRVSEDNARRNGCVHRGCQCNACGMVPI
RGVRYRCANCADFDLCETCEAQGIHVRTHIFYKIRVPAPPFGPRQMQPVWYTGDPDTCRRSLPRGLIAKLSRDTG
FERPELEAFWEQWTFMAFSEWREDPDELGVAMDRRTFERCLVPTGGSRHAAPNLIHDRMFAFYDANNDGLISFSE
FLHGLSYRRRKDKLRKVFEGYDIDGDGFVNRRDFLRMFRAYYVLYKQMHKDILDGLEDQLLASTDAAGVVHSRQP
LSSLFGREGRVPPADGGMRFDGKTLHRDGTVVVDDGHRSTTIESRGDTATREDILTSLFAYETLQQPRRRFVAQR
DTDTNWRTVRRLSANDADRAYWVTLLDPPESLDDLPDVLTGAGLRDAEQTEDEADDEADLNGHRSQHGGDSANGR
RRTTDDMDGTDSERRARMLSRARRKAPKLEKRRRDMARSQLHERWRRRQFYLDEEEGGLAPDDWDQDEDVLAKLR
MAANEAQATAAAAAAAAAQTRSRSSSKVRFAQDMDDFDTRSNPSTSSRSIPERWGGMGVPDAERDAGKEILYQVT
QQAFNELLDTIFKPAEDLAVEAAETKDQRERFRAEIDAVDEATDKAKESDPLPAPEKADREKSAEDAVSEAMLTN
AGMFERRNAVDLEYLVNLSDYTIPSESSVSGDDEPAVEEHRDPTMPQFRPNGPTEDDEEKGKRKREKGKKRPGST
EAEAGENRSGAGSSSGEDGPSSTRSSGSEPSVTTLRRWKQLDEAEVKAAARGGWGRLSFDEFEAIYKNQEDQGNR
LDYLGSWIDFCIP*
Coding >Ophun1|687
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCCTCGTCTCGACCGTTGCC
GCCGTCTCTGCCTGCTACCTCGTCTTCCAGTCCAGCTGGTCCACCGGCTTCCGCGACCGCACCGGCATCACAGGG
GCCTTGCACAGGAGCAACGCCGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGGCGACGAGAATGTCCAGGCAGACCATCTGGCAGCCGAAGTCGAGACGGTCGTCGACGTCGGGGCCGACGAG
TGGTGGAACGACCTGGCCGGCTTCCAGCCCTCGCAACGCGCAGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGCCAATGTAACGCGTGCGGCATGGTGCCCATC
CGCGGAGTTCGCTACCGATGTGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATTCAC
GTCAGGACGCACATCTTCTACAAGATCAGGGTGCCTGCGCCGCCCTTTGGCCCCCGTCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGACACCTGCCGCCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCAGAGCTCGAGGCCTTTTGGGAGCAGTGGACATTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCTATGGATCGGAGGACCTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCACGTCACGCC
GCTCCCAACCTCATTCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGACGGACTCATCAGCTTCTCCGAG
TTTCTCCATGGCCTGTCGTACCGGAGGCGTAAAGATAAGCTCCGCAAGGTCTTTGAGGGCTACGACATCGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTCCGCGCCTACTACGTCTTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTGGAGGACCAGCTTCTCGCCAGCACGGATGCCGCCGGTGTTGTTCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCAGACGGCGGCATGCGCTTCGATGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGTCATCGCAGTACCACGATTGAGAGCCGCGGCGACACGGCGACT
CGCGAAGACATCCTGACGAGCCTCTTCGCCTACGAGACGCTCCAGCAGCCTCGCCGTCGCTTCGTGGCCCAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTCACCCTC
CTGGATCCCCCCGAATCTCTCGACGATCTGCCCGATGTGCTGACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGCCGACCTCAACGGCCACCGGAGCCAACACGGCGGTGACTCCGCCAACGGCCGA
CGACGAACGACGGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGGCGGAAG
GCGCCCAAGTTGGAGAAGCGCCGGCGAGACATGGCGCGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTC
TACCTCGACGAGGAGGAGGGCGGCCTGGCCCCTGACGACTGGGATCAGGACGAGGACGTGTTGGCCAAGCTTAGG
ATGGCGGCCAACGAGGCGCAAGCTACTGCTGCTGCGGCGGCGGCGGCGGCGGCGCAGACGCGTTCACGGTCGAGC
TCCAAGGTGCGGTTCGCCCAAGATATGGACGACTTCGACACGCGATCCAACCCGTCGACGTCGTCACGAAGCATA
CCCGAGCGCTGGGGAGGCATGGGCGTGCCAGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTATCAGGTGACG
CAGCAGGCCTTCAACGAGCTGCTCGACACCATCTTCAAACCAGCCGAGGATCTGGCCGTCGAGGCGGCCGAGACC
AAGGACCAGCGCGAGAGATTCCGGGCTGAGATTGACGCCGTCGACGAGGCCACGGACAAGGCCAAGGAGTCGGAC
CCGCTGCCGGCTCCCGAAAAGGCCGACCGGGAGAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTGACCAAT
GCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGAGTATCTGGTCAACCTCTCCGACTACACCATCCCCTCA
GAGTCATCCGTGTCGGGAGACGACGAGCCGGCCGTCGAGGAGCACCGTGACCCGACGATGCCTCAGTTCCGGCCC
AACGGCCCAACAGAAGACGACGAGGAGAAGGGGAAGAGGAAGAGGGAAAAGGGCAAGAAGCGGCCGGGTTCTACG
GAAGCCGAGGCGGGCGAGAACAGGTCCGGAGCCGGCTCATCGTCGGGCGAGGACGGACCGTCATCCACGCGTTCT
TCCGGCAGCGAGCCTTCGGTGACGACGCTGCGGCGCTGGAAGCAGCTCGACGAAGCCGAGGTCAAGGCTGCGGCG
AGGGGCGGCTGGGGCAGGCTCAGCTTTGACGAGTTTGAGGCCATCTACAAGAACCAGGAAGACCAGGGCAATAGG
CTTGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG
Transcript >Ophun1|687
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCCTCGTCTCGACCGTTGCC
GCCGTCTCTGCCTGCTACCTCGTCTTCCAGTCCAGCTGGTCCACCGGCTTCCGCGACCGCACCGGCATCACAGGG
GCCTTGCACAGGAGCAACGCCGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGGCGACGAGAATGTCCAGGCAGACCATCTGGCAGCCGAAGTCGAGACGGTCGTCGACGTCGGGGCCGACGAG
TGGTGGAACGACCTGGCCGGCTTCCAGCCCTCGCAACGCGCAGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGCCAATGTAACGCGTGCGGCATGGTGCCCATC
CGCGGAGTTCGCTACCGATGTGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATTCAC
GTCAGGACGCACATCTTCTACAAGATCAGGGTGCCTGCGCCGCCCTTTGGCCCCCGTCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGACACCTGCCGCCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCAGAGCTCGAGGCCTTTTGGGAGCAGTGGACATTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCTATGGATCGGAGGACCTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCACGTCACGCC
GCTCCCAACCTCATTCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGACGGACTCATCAGCTTCTCCGAG
TTTCTCCATGGCCTGTCGTACCGGAGGCGTAAAGATAAGCTCCGCAAGGTCTTTGAGGGCTACGACATCGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTCCGCGCCTACTACGTCTTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTGGAGGACCAGCTTCTCGCCAGCACGGATGCCGCCGGTGTTGTTCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCAGACGGCGGCATGCGCTTCGATGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGTCATCGCAGTACCACGATTGAGAGCCGCGGCGACACGGCGACT
CGCGAAGACATCCTGACGAGCCTCTTCGCCTACGAGACGCTCCAGCAGCCTCGCCGTCGCTTCGTGGCCCAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTCACCCTC
CTGGATCCCCCCGAATCTCTCGACGATCTGCCCGATGTGCTGACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGCCGACCTCAACGGCCACCGGAGCCAACACGGCGGTGACTCCGCCAACGGCCGA
CGACGAACGACGGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGGCGGAAG
GCGCCCAAGTTGGAGAAGCGCCGGCGAGACATGGCGCGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTC
TACCTCGACGAGGAGGAGGGCGGCCTGGCCCCTGACGACTGGGATCAGGACGAGGACGTGTTGGCCAAGCTTAGG
ATGGCGGCCAACGAGGCGCAAGCTACTGCTGCTGCGGCGGCGGCGGCGGCGGCGCAGACGCGTTCACGGTCGAGC
TCCAAGGTGCGGTTCGCCCAAGATATGGACGACTTCGACACGCGATCCAACCCGTCGACGTCGTCACGAAGCATA
CCCGAGCGCTGGGGAGGCATGGGCGTGCCAGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTATCAGGTGACG
CAGCAGGCCTTCAACGAGCTGCTCGACACCATCTTCAAACCAGCCGAGGATCTGGCCGTCGAGGCGGCCGAGACC
AAGGACCAGCGCGAGAGATTCCGGGCTGAGATTGACGCCGTCGACGAGGCCACGGACAAGGCCAAGGAGTCGGAC
CCGCTGCCGGCTCCCGAAAAGGCCGACCGGGAGAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTGACCAAT
GCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGAGTATCTGGTCAACCTCTCCGACTACACCATCCCCTCA
GAGTCATCCGTGTCGGGAGACGACGAGCCGGCCGTCGAGGAGCACCGTGACCCGACGATGCCTCAGTTCCGGCCC
AACGGCCCAACAGAAGACGACGAGGAGAAGGGGAAGAGGAAGAGGGAAAAGGGCAAGAAGCGGCCGGGTTCTACG
GAAGCCGAGGCGGGCGAGAACAGGTCCGGAGCCGGCTCATCGTCGGGCGAGGACGGACCGTCATCCACGCGTTCT
TCCGGCAGCGAGCCTTCGGTGACGACGCTGCGGCGCTGGAAGCAGCTCGACGAAGCCGAGGTCAAGGCTGCGGCG
AGGGGCGGCTGGGGCAGGCTCAGCTTTGACGAGTTTGAGGCCATCTACAAGAACCAGGAAGACCAGGGCAATAGG
CTTGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG
Gene >Ophun1|687
ATGTGGCTGTCGACTCCCTCGGTCGAGACGCTGACTCGTCCACGACTGGCCGTGGCCCTCGTCTCGACCGTTGCC
GCCGTCTCTGCCTGCTACCTCGTCTTCCAGTCCAGCTGGTCCACCGGCTTCCGCGACCGCACCGGCATCACAGGG
GCCTTGCACAGGAGCAACGCCGTGAGGCGATCCCGACGTCGGGACACAAACGGCTCCAGCTCGTCTTCGGACGCG
GGCGGCGACGAGAATGTCCAGGCAGACCATCTGGCAGCCGAAGTCGAGACGGTCGTCGACGTCGGGGCCGACGAG
TGGTGGAACGACCTGGCCGGCTTCCAGCCCTCGCAACGCGCAGGCCACAACATCGTGAGCCTGCTGTTCCGCGTC
TCCGAAGACAATGCGCGTCGCAACGGCTGCGTTCACCGCGGCTGCCAATGTAACGCGTGCGGCATGGTGCCCATC
CGCGGAGTTCGCTACCGATGTGCAAACTGCGCCGACTTTGACCTGTGCGAGACGTGCGAGGCCCAAGGCATTCAC
GTCAGGACGCACATCTTCTACAAGATCAGGGTGCCTGCGCCGCCCTTTGGCCCCCGTCAGATGCAGCCCGTGTGG
TACACAGGCGATCCCGACACCTGCCGCCGCAGCTTGCCTCGCGGCCTCATCGCCAAGCTGTCCCGCGATACGGGC
TTCGAGCGGCCAGAGCTCGAGGCCTTTTGGGAGCAGTGGACATTTATGGCCTTTTCCGAATGGCGCGAGGATCCC
GACGAGCTCGGCGTTGCTATGGATCGGAGGACCTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCACGTCACGCC
GCTCCCAACCTCATTCACGACCGCATGTTTGCCTTTTACGACGCCAACAACGACGGACTCATCAGCTTCTCCGAG
TTTCTCCATGGCCTGTCGTACCGGAGGCGTAAAGATAAGCTCCGCAAGGTCTTTGAGGGCTACGACATCGATGGC
GACGGCTTCGTCAACAGGCGAGACTTTCTGCGCATGTTCCGCGCCTACTACGTCTTGTACAAGCAGATGCACAAG
GACATCCTTGACGGGCTGGAGGACCAGCTTCTCGCCAGCACGGATGCCGCCGGTGTTGTTCACAGCCGTCAACCG
CTGAGCAGCCTGTTCGGCCGCGAGGGTAGAGTCCCTCCCGCAGACGGCGGCATGCGCTTCGATGGCAAGACGTTG
CACCGCGACGGGACCGTCGTTGTCGATGACGGTCATCGCAGTACCACGATTGAGAGCCGCGGCGACACGGCGACT
CGCGAAGACATCCTGACGAGCCTCTTCGCCTACGAGACGCTCCAGCAGCCTCGCCGTCGCTTCGTGGCCCAGCGC
GACACCGACACGAACTGGCGCACCGTTAGGCGCCTGAGCGCCAACGATGCCGACCGCGCATACTGGGTCACCCTC
CTGGATCCCCCCGAATCTCTCGACGATCTGCCCGATGTGCTGACGGGCGCCGGCCTCCGAGACGCGGAGCAGACC
GAAGACGAGGCCGACGACGAGGCCGACCTCAACGGCCACCGGAGCCAACACGGCGGTGACTCCGCCAACGGCCGA
CGACGAACGACGGACGACATGGATGGCACCGACAGCGAGCGCCGAGCCAGGATGCTGTCCCGCGCGCGGCGGAAG
GCGCCCAAGTTGGAGAAGCGCCGGCGAGACATGGCGCGCAGCCAGCTTCACGAGAGATGGAGGAGGCGCCAGTTC
TACCTCGACGAGGAGGAGGGCGGCCTGGCCCCTGACGACTGGGATCAGGACGAGGACGTGTTGGCCAAGCTTAGG
ATGGCGGCCAACGAGGCGCAAGCTACTGCTGCTGCGGCGGCGGCGGCGGCGGCGCAGACGCGTTCACGGTCGAGC
TCCAAGGTGCGGTTCGCCCAAGATATGGACGACTTCGACACGCGATCCAACCCGTCGACGTCGTCACGAAGCATA
CCCGAGCGCTGGGGAGGCATGGGCGTGCCAGACGCCGAGAGGGACGCCGGCAAGGAGATTCTCTATCAGGTGACG
CAGCAGGCCTTCAACGAGCTGCTCGACACCATCTTCAAACCAGCCGAGGATCTGGCCGTCGAGGCGGCCGAGACC
AAGGACCAGCGCGAGAGATTCCGGGCTGAGATTGACGCCGTCGACGAGGCCACGGACAAGGCCAAGGAGTCGGAC
CCGCTGCCGGCTCCCGAAAAGGCCGACCGGGAGAAGAGCGCAGAAGACGCCGTGTCCGAGGCCATGCTGACCAAT
GCCGGCATGTTTGAGAGGCGTAATGCCGTTGACCTCGAGTATCTGGTCAACCTCTCCGACTACACCATCCCCTCA
GAGTCATCCGTGTCGGGAGACGACGAGCCGGCCGTCGAGGAGCACCGTGACCCGACGATGCCTCAGTTCCGGCCC
AACGGCCCAACAGAAGACGACGAGGAGAAGGGGAAGAGGAAGAGGGAAAAGGGCAAGAAGCGGCCGGGTTCTACG
GAAGCCGAGGCGGGCGAGAACAGGTCCGGAGCCGGCTCATCGTCGGGCGAGGACGGACCGTCATCCACGCGTTCT
TCCGGCAGCGAGCCTTCGGTGACGACGCTGCGGCGCTGGAAGCAGCTCGACGAAGCCGAGGTCAAGGCTGCGGCG
AGGGGCGGCTGGGGCAGGCTCAGCTTTGACGAGTTTGAGGCCATCTACAAGAACCAGGAAGACCAGGGCAATAGG
CTTGACTACCTCGGTAGCTGGATCGACTTTTGCATTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail