© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|6869 |
| Gene name | |
| Location | Contig_794:1308..1856 |
| Strand | - |
| Gene length (bp) | 548 |
| Transcript length (bp) | 408 |
| Coding sequence length (bp) | 408 |
| Protein length (aa) | 136 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00117 | GATase | Glutamine amidotransferase class-I | 9.6E-12 | 13 | 116 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8LPN3|ADCS_ARATH | Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 | 10 | 110 | 2.0E-11 |
| sp|P32483|PABS_STRGR | Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 | 10 | 116 | 2.0E-11 |
| sp|O94277|PABS_SCHPO | Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 | 10 | 116 | 2.0E-11 |
| sp|P22101|TRPG_VIBPA | Anthranilate synthase component 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpG PE=3 SV=1 | 10 | 122 | 9.0E-11 |
| sp|P18483|TRPG_ASPAW | Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 | 11 | 116 | 3.0E-10 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8LPN3|ADCS_ARATH | Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 | 10 | 110 | 2.0E-11 |
| sp|P32483|PABS_STRGR | Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 | 10 | 116 | 2.0E-11 |
| sp|O94277|PABS_SCHPO | Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 | 10 | 116 | 2.0E-11 |
| sp|P22101|TRPG_VIBPA | Anthranilate synthase component 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpG PE=3 SV=1 | 10 | 122 | 9.0E-11 |
| sp|P18483|TRPG_ASPAW | Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 | 11 | 116 | 3.0E-10 |
| sp|Q9KST3|TRPG_VIBCH | Anthranilate synthase component 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpG PE=3 SV=2 | 10 | 122 | 8.0E-10 |
| sp|Q5V214|TRPG1_HALMA | Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG1 PE=3 SV=1 | 10 | 116 | 1.0E-09 |
| sp|P71381|TRPG_HAEIN | Anthranilate synthase component 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpG PE=3 SV=1 | 10 | 122 | 1.0E-09 |
| sp|P05328|TRPG_ASPNG | Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1 | 11 | 116 | 1.0E-09 |
| sp|P33974|TRPG_HALVD | Anthranilate synthase component 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpG PE=3 SV=2 | 10 | 116 | 5.0E-09 |
| sp|P0CN87|TRPG_CRYNB | Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRP1 PE=3 SV=1 | 12 | 116 | 7.0E-09 |
| sp|P20441|TRPG_LEPBI | Anthranilate synthase component 2 OS=Leptospira biflexa GN=trpG PE=3 SV=2 | 10 | 116 | 9.0E-09 |
| sp|P06531|TRPG_EMENI | Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3 | 11 | 116 | 1.0E-08 |
| sp|Q5Z856|ADCS_ORYSJ | Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1 | 10 | 123 | 1.0E-08 |
| sp|P27710|TRPG_CRYNH | Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=TRP1 PE=3 SV=2 | 12 | 116 | 1.0E-08 |
| sp|P0CN86|TRPG_CRYNJ | Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRP1 PE=3 SV=1 | 12 | 116 | 1.0E-08 |
| sp|O27693|TRPG_METTH | Anthranilate synthase component 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpG PE=3 SV=1 | 11 | 116 | 2.0E-08 |
| sp|P37254|PABS_YEAST | Aminodeoxychorismate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABZ1 PE=1 SV=4 | 11 | 116 | 2.0E-08 |
| sp|Q02003|TRPG_LACLA | Anthranilate synthase component 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpG PE=3 SV=1 | 11 | 116 | 2.0E-08 |
| sp|P24773|TRPG_PENCH | Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1 | 11 | 116 | 3.0E-08 |
| sp|Q92370|TRPG_SCHPO | Multifunctional tryptophan biosynthesis protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp1 PE=2 SV=2 | 9 | 116 | 4.0E-08 |
| sp|Q9HPG6|TRPG_HALSA | Anthranilate synthase component 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpG PE=3 SV=1 | 10 | 116 | 5.0E-08 |
| sp|P28819|PABA_BACSU | Aminodeoxychorismate/anthranilate synthase component 2 OS=Bacillus subtilis (strain 168) GN=pabA PE=2 SV=1 | 11 | 116 | 8.0E-08 |
| sp|P00901|TRPG_PSEPU | Anthranilate synthase component 2 OS=Pseudomonas putida GN=trpG PE=1 SV=2 | 11 | 116 | 1.0E-07 |
| sp|Q8ZEG6|TRPG_YERPE | Anthranilate synthase component 2 OS=Yersinia pestis GN=trpG PE=3 SV=1 | 11 | 130 | 2.0E-07 |
| sp|P00906|TRPG_SHIDY | Anthranilate synthase component II (Fragment) OS=Shigella dysenteriae GN=trpG-TRPD PE=3 SV=2 | 11 | 131 | 2.0E-07 |
| sp|Q08654|TRPGD_THEMA | Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 | 9 | 116 | 4.0E-07 |
| sp|P00900|TRPG_SERMA | Anthranilate synthase component 2 OS=Serratia marcescens GN=trpG PE=1 SV=2 | 11 | 130 | 8.0E-07 |
| sp|P00904|TRPGD_ECOLI | Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3 | 11 | 130 | 1.0E-06 |
| sp|Q06129|TRPG_SULSO | Anthranilate synthase component 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpG PE=1 SV=2 | 12 | 116 | 2.0E-06 |
| sp|P25170|TRPG_PHACH | Multifunctional tryptophan biosynthesis protein OS=Phanerochaete chrysosporium GN=TRPC PE=3 SV=1 | 8 | 129 | 2.0E-06 |
| sp|P20409|TRPG_PHYBL | Multifunctional tryptophan biosynthesis protein OS=Phycomyces blakesleeanus GN=trp1 PE=3 SV=1 | 12 | 116 | 2.0E-06 |
| sp|P20576|TRPG_PSEAE | Anthranilate synthase component 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=3 SV=2 | 11 | 116 | 2.0E-06 |
| sp|P09575|TRPG_PICAN | Multifunctional tryptophan biosynthesis protein (Fragment) OS=Pichia angusta PE=3 SV=1 | 9 | 116 | 2.0E-06 |
| sp|P00905|TRPGD_SALTY | Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4 | 11 | 130 | 3.0E-06 |
| sp|P00908|TRPG_NEUCR | Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2 | 11 | 123 | 7.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|6869 MPLSNHPPRRILFLDAYDSFTNNIVALLKDVLGHQLTVQVLHMDLKTLDSDPSPDWTPEEFLARLPAFDAVVCGP GPGSPLRDADVGAFKLLWRHGSVPVLGICLGFQSLVVHFGGFCWGGGVGGCLSGEVRVRA* |
| Coding | >Ophun1|6869 ATGCCCCTCTCCAACCACCCGCCCAGACGCATCCTCTTCCTCGACGCCTACGACTCCTTCACAAACAACATCGTC GCCCTCCTCAAAGATGTCCTCGGCCACCAACTCACAGTCCAGGTGCTGCACATGGATCTCAAGACGCTCGACTCA GACCCCAGCCCCGACTGGACGCCAGAAGAGTTCCTCGCCCGGTTACCTGCCTTTGACGCCGTCGTCTGCGGTCCC GGTCCCGGCTCGCCCCTCCGAGACGCCGACGTCGGAGCCTTCAAGCTTCTCTGGCGTCACGGCTCTGTGCCGGTC TTGGGAATCTGCCTCGGGTTCCAGAGCCTGGTTGTTCATTTTGGCGGATTCTGTTGGGGAGGCGGAGTGGGAGGC TGCCTGTCGGGGGAGGTTCGCGTGCGCGCCTGA |
| Transcript | >Ophun1|6869 ATGCCCCTCTCCAACCACCCGCCCAGACGCATCCTCTTCCTCGACGCCTACGACTCCTTCACAAACAACATCGTC GCCCTCCTCAAAGATGTCCTCGGCCACCAACTCACAGTCCAGGTGCTGCACATGGATCTCAAGACGCTCGACTCA GACCCCAGCCCCGACTGGACGCCAGAAGAGTTCCTCGCCCGGTTACCTGCCTTTGACGCCGTCGTCTGCGGTCCC GGTCCCGGCTCGCCCCTCCGAGACGCCGACGTCGGAGCCTTCAAGCTTCTCTGGCGTCACGGCTCTGTGCCGGTC TTGGGAATCTGCCTCGGGTTCCAGAGCCTGGTTGTTCATTTTGGCGGATTCTGTTGGGGAGGCGGAGTGGGAGGC TGCCTGTCGGGGGAGGTTCGCGTGCGCGCCTGA |
| Gene | >Ophun1|6869 ATGCCCCTCTCCAACCACCCGCCCAGACGCATCCTCTTCCTCGACGCCTACGACTCCTTCACAAACAACATCGTC GCCCTCCTCAAAGATGTCCTCGGCCACCAACTCACAGTCCAGGTGCTGCACATGGATCTCAAGACGCTCGACTCA GACCCCAGCCCCGACTGGACGCCAGAAGAGTTCCTCGCCCGGTTACCTGCCTTTGACGCCGTCGTCTGCGGTCCC GGTCCCGGCTCGCCCCTCCGAGACGCCGACGTCGGAGCCTTCAAGCTTCTCTGGCGTCACGGCTCTGTGCCGGTC TTGGGAATCTGCCTCGGGTTCCAGAGCCTGGTTGTTCATTTTGGCGGTGGGATTCGCAGGCTTAGACGGAGGGGG TTGCATGGGCTTGTTCGGGTTGTTGAGCCTGTTGATGAGCGTGATGTGTTTCGAGGGGTTGGGGCGTTTGGTGCC ACGCTTTACCATAGTCTCTGCGCTGATCTTGGTCAGGATTCTGTTGGGGAGGCGGAGTGGGAGGCTGCCTGTCGG GGGAGGTTCGCGTGCGCGCCTGA |