Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6856
Gene name
LocationContig_79:34873..37685
Strand+
Gene length (bp)2812
Transcript length (bp)2700
Coding sequence length (bp)2700
Protein length (aa) 900

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.6E-146 188 850

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 85 873 1.0E-140
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 8 893 1.0E-134
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 167 870 7.0E-123
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 166 896 4.0E-122
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 164 864 1.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 85 873 1.0E-140
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 8 893 1.0E-134
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 167 870 7.0E-123
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 166 896 4.0E-122
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 164 864 1.0E-119
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 165 863 2.0E-115
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 165 861 4.0E-115
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 144 858 1.0E-112
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 167 866 1.0E-111
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 157 883 2.0E-111
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 164 888 4.0E-110
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 171 863 9.0E-104
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 160 863 2.0E-94
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 148 873 1.0E-85
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 189 211 22
2 216 238 22
3 365 384 19
4 394 416 22
5 437 459 22
6 513 535 22
7 573 595 22
8 600 622 22
9 629 651 22
10 681 703 22
11 752 771 19
12 786 808 22
13 828 850 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6856
MADEDEKEDSSSTKDTLTNGSESSSSRPLSSSTLNEKIWTQPKDDKSSDFDLTLKLEEPADLDLAFKLEKPSDPH
SSPNQPNVKLEESSELQSQDSTETLSEEALDAQLKDLIIKHEFDQNFPTELLTRARAFTQGTNGARSEAEIAAGH
EAIKSFRDFDELIRNSSPYIEVRSVVDVTDDPSVPVGTFRVFVLGTFFTAVGSGISQFFSLRLPSIEISTFVIQL
LAMPLGIAMARWIPKDKHVGFRGWTVNLNPGEFTQKEHLLVAMMGNTLNSPYIVSIVQVLKLDLFYGEKVLSSSI
LWQVLTLVSSQLLGYGCAGLTRRFLIYPPAMIWPRVLPAIALSKALRRDGESSAWGIMTISRNRFFMVAFAAMFV
WFWIPNYLFQALSLFNWTTWFSPASTTVALITGSTCGLGFFNPLPSLDWNIVTSLGDPIVTPLFTLLNFAAGMIL
SGLLAIPLYFGNFMNGAYLPINSNKIYDNTANVYDVKRVLTSDLNLNVEAYFNYAIPYMSTTVLIQMVAHFVVYI
AVPLHIFLYFRRDIAAGIRSAWSRKSREDEFSDIHNRLMSAYPEVPHWWYGIVLLISFVIACIAVSAFPTGMPIW
GLLVAIGFTLLLQIPIGMLAAISNVEVSTSILAFLIAGFTLEGQVIGNMIFKMYSYLATSQSLNFVGDLKMAHYC
KIPPRWAFAAQLYASMLGGFISLGVNHWSLSNIKGICQEGQAERFVCPHTHKFFINTVLWSAIGPRRLFGSDGPY
RGTLYFLPLGIVLPLLVYWGARRWPSSWLRHVNTPIFIAGAVAWAPLNFSYMQGTVVLALFFNRYVKKRYNAWWQ
KYAYVLTASFSAATGVAALFLFFAFQRWNVKVDWIGNSIAGQGVDQGGFKFANGTTLKCSNLKLQPGESFATGF*
Coding >Ophun1|6856
ATGGCAGATGAAGACGAAAAGGAAGACTCTTCGTCTACTAAAGATACCCTCACCAACGGATCCGAGAGTTCATCC
TCACGACCCCTAAGCTCATCAACCCTCAACGAAAAGATATGGACACAGCCCAAGGACGACAAATCTTCAGACTTT
GACTTGACCCTCAAGCTCGAGGAACCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAGCCATCAGACCCCCAC
TCATCCCCCAACCAACCAAACGTCAAACTCGAAGAATCATCAGAACTCCAATCCCAAGACTCAACAGAAACCCTC
TCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCGACCGAG
CTCCTCACCCGCGCCCGCGCCTTCACGCAGGGAACAAACGGCGCCCGATCAGAGGCCGAGATAGCAGCCGGCCAT
GAAGCCATCAAGTCGTTCCGTGACTTTGACGAGCTCATCAGGAATAGCAGTCCGTACATAGAGGTCCGTTCCGTC
GTTGACGTCACCGATGATCCCTCTGTTCCGGTCGGTACTTTCCGCGTCTTTGTGCTGGGGACTTTCTTTACGGCT
GTGGGCAGTGGCATCAGTCAGTTCTTTTCTTTGAGGCTGCCCAGCATTGAGATCTCTACCTTTGTCATTCAGTTG
CTTGCCATGCCGCTCGGAATCGCCATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGAGGCTGGACC
GTCAACCTCAACCCCGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTCAACAGT
CCCTACATCGTCTCCATCGTCCAAGTTCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTGTCATCGTCTATC
CTGTGGCAGGTCCTCACTCTCGTTTCCTCACAACTCCTCGGCTATGGCTGCGCCGGCTTGACGAGACGCTTCCTC
ATCTACCCGCCTGCCATGATCTGGCCGAGGGTCCTCCCCGCAATCGCCCTGTCCAAGGCTCTACGACGGGATGGC
GAGTCTTCCGCCTGGGGCATCATGACGATTTCGCGGAATCGGTTCTTCATGGTTGCCTTTGCGGCCATGTTCGTC
TGGTTCTGGATCCCGAATTACCTGTTCCAGGCTCTGTCACTCTTCAACTGGACGACTTGGTTCTCTCCGGCAAGC
ACGACGGTGGCTCTCATTACCGGCAGCACGTGCGGGCTCGGGTTCTTCAACCCTCTTCCCTCACTGGATTGGAAC
ATTGTCACCAGTTTGGGAGACCCGATTGTCACTCCGCTGTTTACGTTGCTGAACTTTGCTGCGGGGATGATCCTC
TCCGGTCTGCTGGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGCGCCTATCTGCCAATCAACAGCAACAAG
ATCTATGACAACACGGCCAACGTCTACGACGTCAAGAGGGTACTGACTTCCGATCTCAACCTGAACGTGGAGGCC
TACTTCAACTACGCCATCCCTTACATGTCGACGACGGTGCTGATCCAGATGGTGGCTCACTTCGTCGTCTACATC
GCCGTGCCCCTTCACATCTTCCTATACTTCAGAAGAGACATCGCCGCCGGCATCCGCTCAGCCTGGAGCCGCAAG
TCTCGGGAAGACGAGTTTAGCGATATCCACAACCGCTTAATGTCTGCTTACCCCGAGGTGCCGCACTGGTGGTAC
GGCATCGTTCTTCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACAGGGATGCCCATTTGG
GGGCTTCTCGTCGCCATTGGCTTCACCTTGTTGCTTCAGATTCCCATCGGTATGCTCGCGGCCATCTCCAACGTG
GAGGTTTCGACGTCCATCTTGGCCTTTCTCATTGCGGGCTTCACTCTGGAGGGGCAAGTTATTGGCAACATGATT
TTCAAGATGTATTCCTACTTGGCCACCAGTCAATCCTTGAACTTTGTCGGCGACCTGAAGATGGCACATTACTGC
AAGATCCCCCCTCGTTGGGCCTTTGCCGCTCAGCTATACGCCTCTATGCTCGGCGGCTTCATCTCCCTCGGCGTC
AACCACTGGAGCCTTAGCAACATTAAAGGGATATGCCAAGAAGGCCAGGCCGAGCGCTTCGTCTGCCCCCACACC
CACAAGTTCTTCATCAACACGGTCCTCTGGAGCGCCATCGGACCTCGAAGGCTCTTCGGAAGCGATGGTCCCTAC
CGAGGTACGCTCTACTTTCTGCCACTGGGCATCGTGCTCCCCCTGCTCGTCTATTGGGGGGCACGCCGCTGGCCG
AGTTCGTGGCTGCGTCACGTCAACACTCCCATCTTCATTGCCGGCGCTGTGGCTTGGGCTCCCTTGAACTTCTCA
TACATGCAGGGCACGGTTGTGCTCGCCTTGTTCTTCAACCGCTACGTCAAGAAGCGGTACAATGCTTGGTGGCAG
AAGTACGCCTACGTGCTCACGGCGTCCTTTTCAGCCGCCACCGGCGTCGCCGCTCTGTTCCTCTTCTTTGCGTTT
CAGAGATGGAACGTCAAAGTTGACTGGATTGGCAACTCGATTGCTGGCCAGGGTGTTGACCAAGGAGGCTTCAAG
TTTGCAAACGGGACGACGCTCAAGTGTTCTAACCTCAAATTGCAACCGGGAGAGTCGTTTGCCACTGGCTTCTAA
Transcript >Ophun1|6856
ATGGCAGATGAAGACGAAAAGGAAGACTCTTCGTCTACTAAAGATACCCTCACCAACGGATCCGAGAGTTCATCC
TCACGACCCCTAAGCTCATCAACCCTCAACGAAAAGATATGGACACAGCCCAAGGACGACAAATCTTCAGACTTT
GACTTGACCCTCAAGCTCGAGGAACCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAGCCATCAGACCCCCAC
TCATCCCCCAACCAACCAAACGTCAAACTCGAAGAATCATCAGAACTCCAATCCCAAGACTCAACAGAAACCCTC
TCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCGACCGAG
CTCCTCACCCGCGCCCGCGCCTTCACGCAGGGAACAAACGGCGCCCGATCAGAGGCCGAGATAGCAGCCGGCCAT
GAAGCCATCAAGTCGTTCCGTGACTTTGACGAGCTCATCAGGAATAGCAGTCCGTACATAGAGGTCCGTTCCGTC
GTTGACGTCACCGATGATCCCTCTGTTCCGGTCGGTACTTTCCGCGTCTTTGTGCTGGGGACTTTCTTTACGGCT
GTGGGCAGTGGCATCAGTCAGTTCTTTTCTTTGAGGCTGCCCAGCATTGAGATCTCTACCTTTGTCATTCAGTTG
CTTGCCATGCCGCTCGGAATCGCCATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGAGGCTGGACC
GTCAACCTCAACCCCGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTCAACAGT
CCCTACATCGTCTCCATCGTCCAAGTTCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTGTCATCGTCTATC
CTGTGGCAGGTCCTCACTCTCGTTTCCTCACAACTCCTCGGCTATGGCTGCGCCGGCTTGACGAGACGCTTCCTC
ATCTACCCGCCTGCCATGATCTGGCCGAGGGTCCTCCCCGCAATCGCCCTGTCCAAGGCTCTACGACGGGATGGC
GAGTCTTCCGCCTGGGGCATCATGACGATTTCGCGGAATCGGTTCTTCATGGTTGCCTTTGCGGCCATGTTCGTC
TGGTTCTGGATCCCGAATTACCTGTTCCAGGCTCTGTCACTCTTCAACTGGACGACTTGGTTCTCTCCGGCAAGC
ACGACGGTGGCTCTCATTACCGGCAGCACGTGCGGGCTCGGGTTCTTCAACCCTCTTCCCTCACTGGATTGGAAC
ATTGTCACCAGTTTGGGAGACCCGATTGTCACTCCGCTGTTTACGTTGCTGAACTTTGCTGCGGGGATGATCCTC
TCCGGTCTGCTGGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGCGCCTATCTGCCAATCAACAGCAACAAG
ATCTATGACAACACGGCCAACGTCTACGACGTCAAGAGGGTACTGACTTCCGATCTCAACCTGAACGTGGAGGCC
TACTTCAACTACGCCATCCCTTACATGTCGACGACGGTGCTGATCCAGATGGTGGCTCACTTCGTCGTCTACATC
GCCGTGCCCCTTCACATCTTCCTATACTTCAGAAGAGACATCGCCGCCGGCATCCGCTCAGCCTGGAGCCGCAAG
TCTCGGGAAGACGAGTTTAGCGATATCCACAACCGCTTAATGTCTGCTTACCCCGAGGTGCCGCACTGGTGGTAC
GGCATCGTTCTTCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACAGGGATGCCCATTTGG
GGGCTTCTCGTCGCCATTGGCTTCACCTTGTTGCTTCAGATTCCCATCGGTATGCTCGCGGCCATCTCCAACGTG
GAGGTTTCGACGTCCATCTTGGCCTTTCTCATTGCGGGCTTCACTCTGGAGGGGCAAGTTATTGGCAACATGATT
TTCAAGATGTATTCCTACTTGGCCACCAGTCAATCCTTGAACTTTGTCGGCGACCTGAAGATGGCACATTACTGC
AAGATCCCCCCTCGTTGGGCCTTTGCCGCTCAGCTATACGCCTCTATGCTCGGCGGCTTCATCTCCCTCGGCGTC
AACCACTGGAGCCTTAGCAACATTAAAGGGATATGCCAAGAAGGCCAGGCCGAGCGCTTCGTCTGCCCCCACACC
CACAAGTTCTTCATCAACACGGTCCTCTGGAGCGCCATCGGACCTCGAAGGCTCTTCGGAAGCGATGGTCCCTAC
CGAGGTACGCTCTACTTTCTGCCACTGGGCATCGTGCTCCCCCTGCTCGTCTATTGGGGGGCACGCCGCTGGCCG
AGTTCGTGGCTGCGTCACGTCAACACTCCCATCTTCATTGCCGGCGCTGTGGCTTGGGCTCCCTTGAACTTCTCA
TACATGCAGGGCACGGTTGTGCTCGCCTTGTTCTTCAACCGCTACGTCAAGAAGCGGTACAATGCTTGGTGGCAG
AAGTACGCCTACGTGCTCACGGCGTCCTTTTCAGCCGCCACCGGCGTCGCCGCTCTGTTCCTCTTCTTTGCGTTT
CAGAGATGGAACGTCAAAGTTGACTGGATTGGCAACTCGATTGCTGGCCAGGGTGTTGACCAAGGAGGCTTCAAG
TTTGCAAACGGGACGACGCTCAAGTGTTCTAACCTCAAATTGCAACCGGGAGAGTCGTTTGCCACTGGCTTCTAA
Gene >Ophun1|6856
ATGGCAGATGAAGACGAAAAGGAAGACTCTTCGTCTACTAAAGATACCCTCACCAACGGATCCGAGAGTTCATCC
TCACGACCCCTAAGCTCATCAACCCTCAACGAAAAGATATGGACACAGCCCAAGGACGACAAATCTTCAGACTTT
GACTTGACCCTCAAGCTCGAGGAACCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAGCCATCAGACCCCCAC
TCATCCCCCAACCAACCAAACGTCAAACTCGAAGAATCATCAGAACTCCAATCCCAAGACTCAACAGAAACCCTC
TCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCGACCGAG
CTCCTCACCCGCGCCCGCGCCTTCACGCAGGGAACAAACGGCGCCCGATCAGAGGCCGAGATAGCAGCCGGCCAT
GAAGCCATCAAGTCGTTCCGTGACTTTGACGAGCTCATCAGGAATAGCAGTCCGTACATAGAGGTCCGTTCCGTC
GTTGACGTCACCGATGATCCCTCTGTTCCGGTCGGTACTTTCCGCGTCTTTGTGCTGGGGACTTTCTTTACGGCT
GTGGGCAGTGGCATCAGTCAGTTCTTTTCTTTGAGGCTGCCCAGCATTGAGATCTCTACCTTTGTCATTCAGTTG
CTTGCCATGCCGCTCGGAATCGCCATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGAGGCTGGACC
GTCAACCTCAACCCCGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTCAACAGT
CCCTACATCGTCTCCATCGTCCAAGTTCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTGTCATCGTCTATC
CTGTGGCAGGTCCTCACTCTCGTTTCCTCACAACTCCTCGGCTATGGCTGCGCCGGCTTGACGAGACGCTTCCTC
ATCTACCCGCCTGCCATGATCTGGCCGAGGGTCCTCCCCGCAATCGCCCTGTCCAAGGCTCTACGACGGGATGGC
GAGTCTTCCGCCTGGGGCATCATGACGATTTCGCGGAATCGGTTCTTCATGGTTGCCTTTGCGGCCATGTTCGTC
TGGTTCTGGATCCCGAATTACCTGTTCCAGGCTCTGTCACTCTTCAACTGGACGACTTGGTTCTCTCCGGCAAGC
ACGACGGTGGCTCTCATTACCGGCAGCACGTGCGGGCTCGGGTTCTTCAACCCTCTTCCCTCACTGGATTGGAAC
ATTGTCACCAGTTTGGGAGACCCGATTGTCACTCCGCTGTTTACGTTGCTGAACTTTGCTGCGGGGATGATCCTC
TCCGGTCTGCTGGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGCGCCTATCTGCCAATCAACAGCAACAAG
ATCTATGACAACACGGCCAACGTCTACGACGTCAAGAGGGTACTGACTTCCGATCTCAACCTGAACGTGGAGGCC
TACTTCAACTACGCCATCCCTTACATGTCGACGACGGTGCTGATCCAGATGGTGGCTCACTTCGTCGTCTACATC
GCCGTGCCCCTTCACATCTTCCTATACTTCAGAAGAGACATCGCCGCCGGCATCCGCTCAGCCTGGAGCCGCAAG
TCTCGGGAAGACGAGTTTAGCGATATCCACAACCGCTTAATGTCTGCTTACCCCGAGGTGCCGCACTGGTGGTAC
GGCATCGTTCTTCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACAGGGATGCCCATTTGG
GGGCTTCTCGTCGCCATTGGCTTCACCTTGTTGCTTCAGATTCCCATCGGTATGCTCGCGGCCATCTCCAACGTG
GAGGTTTCGACGTCCATCTTGGCCTTTCTCATTGCGGGCTTCACTCTGGAGGGGCAAGTTATTGGCAACATGATT
TTCAAGATGTATTCCTACTTGGCCACCAGGTATGTTGCCTTCTGTATCTCTTCTGCCCTGAGTGCTCGCTGACTT
TTGCTGCTTCAGTCAATCCTTGAACTTTGTCGGCGACCTGAAGATGGTAATTCCTCATCCGCTCTTACACCCTAA
TCTCTGTTTGCTGATCGTTTTACAGGCACATTACTGCAAGATCCCCCCTCGTTGGGCCTTTGCCGCTCAGCTATA
CGCCTCTATGCTCGGCGGCTTCATCTCCCTCGGCGTCAACCACTGGAGCCTTAGCAACATTAAAGGGATATGCCA
AGAAGGCCAGGCCGAGCGCTTCGTCTGCCCCCACACCCACAAGTTCTTCATCAACACGGTCCTCTGGAGCGCCAT
CGGACCTCGAAGGCTCTTCGGAAGCGATGGTCCCTACCGAGGTACGCTCTACTTTCTGCCACTGGGCATCGTGCT
CCCCCTGCTCGTCTATTGGGGGGCACGCCGCTGGCCGAGTTCGTGGCTGCGTCACGTCAACACTCCCATCTTCAT
TGCCGGCGCTGTGGCTTGGGCTCCCTTGAACTTCTCATACATGCAGGGCACGGTTGTGCTCGCCTTGTTCTTCAA
CCGCTACGTCAAGAAGCGGTACAATGCTTGGTGGCAGAAGTACGCCTACGTGCTCACGGCGTCCTTTTCAGCCGC
CACCGGCGTCGCCGCTCTGTTCCTCTTCTTTGCGTTTCAGAGATGGAACGTCAAAGTTGACTGGATTGGCAACTC
GATTGCTGGCCAGGGTGTTGACCAAGGAGGCTTCAAGTTTGCAAACGGGACGACGCTCAAGTGTTCTAACCTCAA
ATTGCAACCGGGAGAGTCGTTTGCCACTGGCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail