Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6855
Gene name
LocationContig_79:29288..32789
Strand-
Gene length (bp)3501
Transcript length (bp)3222
Coding sequence length (bp)3222
Protein length (aa) 1074

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.7E-70 10 464
PF00667 FAD_binding_1 FAD binding domain 2.6E-24 688 893
PF00258 Flavodoxin_1 Flavodoxin 5.3E-19 512 635
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.8E-10 926 1031

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 5 1072 0.0E+00
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 5 1073 0.0E+00
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 3 1073 0.0E+00
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 5 1069 0.0E+00
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 498 1072 4.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 5 1072 0.0E+00
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 5 1073 0.0E+00
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 3 1073 0.0E+00
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 5 1069 0.0E+00
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 498 1072 4.0E-56
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 512 1073 2.0E-52
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 512 1073 1.0E-50
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 512 1073 1.0E-49
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 512 1073 2.0E-49
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 512 1073 2.0E-49
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 486 1073 4.0E-47
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 512 1073 5.0E-47
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 510 1073 7.0E-47
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 464 1073 6.0E-46
sp|P37116|NCPR_VIGRR NADPH--cytochrome P450 reductase OS=Vigna radiata var. radiata PE=1 SV=1 506 1072 4.0E-44
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 506 1072 2.0E-43
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 483 1073 2.0E-43
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 512 1073 5.0E-43
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 483 1073 7.0E-43
sp|Q2UHA7|NCPR_ASPOR NADPH--cytochrome P450 reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cprA PE=3 SV=1 512 1073 2.0E-42
sp|A2QS05|NCPR_ASPNC NADPH--cytochrome P450 reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cprA PE=3 SV=1 483 1073 2.0E-42
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 483 1073 2.0E-41
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 512 1072 2.0E-41
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 484 1073 1.0E-40
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 505 1072 2.0E-40
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 499 1072 5.0E-39
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 510 1072 5.0E-39
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 499 1072 8.0E-39
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 512 1072 2.0E-38
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 510 1072 2.0E-38
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 512 1073 2.0E-38
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 495 1072 5.0E-38
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 510 1072 6.0E-38
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Catharanthus roseus GN=CPR PE=2 SV=1 505 1072 6.0E-38
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 510 1072 2.0E-37
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 512 1072 6.0E-37
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 512 1072 7.0E-37
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 486 1072 7.0E-37
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 505 1072 1.0E-36
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 512 1072 3.0E-35
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 443 1055 5.0E-35
sp|A8G9X6|CYSJ_SERP5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Serratia proteamaculans (strain 568) GN=cysJ PE=3 SV=1 512 1072 6.0E-35
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 499 1072 1.0E-34
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 499 1072 2.0E-34
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 512 1072 2.0E-34
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 96 443 3.0E-34
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 512 1072 3.0E-34
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 512 1072 5.0E-34
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 512 1072 9.0E-34
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 512 1072 1.0E-33
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 512 1072 1.0E-33
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 512 1072 1.0E-33
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 558 1072 5.0E-33
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 558 1072 5.0E-33
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 510 1073 7.0E-33
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 687 1072 1.0E-32
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 508 1072 6.0E-32
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 12 472 8.0E-32
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 33 463 1.0E-31
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-7) GN=cysJ PE=3 SV=1 512 1072 2.0E-31
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 12 463 3.0E-31
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 552 1072 3.0E-31
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 512 1072 4.0E-31
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 512 1072 4.0E-31
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 512 1072 6.0E-31
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 113 463 7.0E-31
sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 512 1072 9.0E-31
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 512 1072 1.0E-30
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 55 471 1.0E-30
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 113 463 1.0E-30
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 55 441 1.0E-30
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 512 1072 2.0E-30
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 512 1072 2.0E-30
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 512 1072 2.0E-30
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 512 1072 2.0E-30
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 113 459 2.0E-30
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 551 1072 2.0E-30
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 512 1072 2.0E-30
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 512 1072 4.0E-30
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 499 1072 4.0E-30
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 499 1072 4.0E-30
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 512 1072 5.0E-30
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 512 1072 5.0E-30
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 220 463 7.0E-30
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 220 463 7.0E-30
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 512 1072 7.0E-30
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 220 463 7.0E-30
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 512 1072 7.0E-30
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 512 1072 9.0E-30
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 512 1072 1.0E-29
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 512 1072 1.0E-29
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 558 1072 1.0E-29
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 109 443 1.0E-29
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 5 463 2.0E-29
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 558 1072 2.0E-29
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 109 443 2.0E-29
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 512 1072 2.0E-29
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 109 443 2.0E-29
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis GN=cysJ PE=3 SV=1 558 1072 3.0E-29
sp|Q1C3Z0|CYSJ_YERPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysJ PE=3 SV=1 558 1072 3.0E-29
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 227 442 4.0E-29
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 5 442 4.0E-29
sp|P16603|NCPR_YEAST NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3 512 1072 4.0E-29
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 249 472 5.0E-29
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 512 1072 5.0E-29
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 558 1072 8.0E-29
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 109 463 9.0E-29
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis (strain Pestoides F) GN=cysJ PE=3 SV=1 558 1072 1.0E-28
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysJ PE=3 SV=1 558 1072 1.0E-28
sp|A7FLZ0|CYSJ_YERP3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysJ PE=3 SV=1 558 1072 1.0E-28
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 109 457 1.0E-28
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 551 1072 2.0E-28
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 3 445 2.0E-28
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 512 1072 2.0E-28
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 1 469 2.0E-28
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 109 442 2.0E-28
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 101 440 3.0E-28
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 101 440 3.0E-28
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 101 440 4.0E-28
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 551 1072 4.0E-28
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 223 442 4.0E-28
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 551 1072 4.0E-28
sp|O19114|NOS2_RABIT Nitric oxide synthase, inducible (Fragment) OS=Oryctolagus cuniculus GN=NOS2 PE=2 SV=1 720 1072 5.0E-28
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 113 442 5.0E-28
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysJ PE=3 SV=1 558 1072 5.0E-28
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 512 1032 6.0E-28
sp|Q6BR77|NDOR1_DEBHA NADPH-dependent diflavin oxidoreductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TAH18 PE=3 SV=2 499 1072 6.0E-28
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 223 442 7.0E-28
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 512 1072 7.0E-28
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 512 1072 8.0E-28
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 227 442 9.0E-28
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 551 1072 1.0E-27
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 109 441 1.0E-27
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 109 462 1.0E-27
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 512 1072 1.0E-27
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 223 461 2.0E-27
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 227 442 2.0E-27
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 229 442 3.0E-27
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 111 448 3.0E-27
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 512 1072 7.0E-27
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 5 442 8.0E-27
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 5 470 8.0E-27
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 98 456 9.0E-27
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 113 440 9.0E-27
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 5 440 1.0E-26
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 63 449 1.0E-26
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 512 1072 1.0E-26
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 113 440 2.0E-26
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 113 442 2.0E-26
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 512 1072 3.0E-26
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 510 1073 3.0E-26
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 721 1073 3.0E-26
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 101 440 3.0E-26
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 216 463 3.0E-26
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 510 1072 4.0E-26
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 106 472 4.0E-26
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 5 440 4.0E-26
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 109 441 5.0E-26
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 113 442 5.0E-26
sp|Q28969|NOS3_PIG Nitric oxide synthase, endothelial OS=Sus scrofa GN=NOS3 PE=1 SV=4 682 1072 5.0E-26
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 512 1072 5.0E-26
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 92 466 6.0E-26
sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 512 1072 8.0E-26
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 5 442 1.0E-25
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 55 434 2.0E-25
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 228 442 2.0E-25
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 101 440 2.0E-25
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 512 1072 2.0E-25
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 239 442 2.0E-25
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 101 442 2.0E-25
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 589 1072 3.0E-25
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 113 476 4.0E-25
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 54 440 4.0E-25
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 101 440 5.0E-25
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 101 440 6.0E-25
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 112 480 6.0E-25
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 5 440 8.0E-25
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 510 1073 8.0E-25
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 113 448 9.0E-25
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 5 440 9.0E-25
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 512 1072 2.0E-24
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 3 472 2.0E-24
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 239 461 2.0E-24
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 113 440 2.0E-24
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 101 440 3.0E-24
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 589 1072 3.0E-24
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 510 1043 4.0E-24
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 512 1072 4.0E-24
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 258 459 5.0E-24
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 109 441 5.0E-24
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 721 1073 6.0E-24
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 101 459 1.0E-23
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 107 448 1.0E-23
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 113 440 2.0E-23
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 86 443 2.0E-23
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 54 442 2.0E-23
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 237 440 2.0E-23
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 109 463 2.0E-23
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 512 1073 2.0E-23
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 112 443 2.0E-23
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 64 461 3.0E-23
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 97 459 3.0E-23
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 5 460 3.0E-23
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 64 443 4.0E-23
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 109 463 5.0E-23
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 67 443 6.0E-23
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 112 443 6.0E-23
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 101 463 6.0E-23
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 81 440 7.0E-23
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 112 469 7.0E-23
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 271 442 7.0E-23
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 701 1072 8.0E-23
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 113 440 9.0E-23
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 6 459 1.0E-22
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 3 447 1.0E-22
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 7 443 1.0E-22
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 92 461 2.0E-22
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 512 1072 2.0E-22
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 3 468 2.0E-22
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 111 463 3.0E-22
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 113 440 4.0E-22
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 113 440 5.0E-22
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 88 440 5.0E-22
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 113 440 7.0E-22
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 109 442 8.0E-22
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 92 461 1.0E-21
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 109 469 1.0E-21
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 5 463 1.0E-21
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 110 448 1.0E-21
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 112 469 1.0E-21
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 112 442 1.0E-21
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 113 469 2.0E-21
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 113 436 2.0E-21
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 258 480 2.0E-21
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 3 471 3.0E-21
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 101 463 3.0E-21
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 3 472 3.0E-21
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 111 440 3.0E-21
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 101 480 4.0E-21
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 113 461 4.0E-21
sp|Q9W223|CP6D2_DROME Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 112 440 6.0E-21
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 248 459 6.0E-21
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 113 440 7.0E-21
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 64 461 7.0E-21
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 5 440 1.0E-20
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 65 461 1.0E-20
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 111 440 2.0E-20
sp|Q75B78|NDOR1_ASHGO NADPH-dependent diflavin oxidoreductase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TAH18 PE=3 SV=1 508 1031 2.0E-20
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 113 443 2.0E-20
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 6 443 2.0E-20
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 111 443 2.0E-20
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 101 463 2.0E-20
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 54 461 2.0E-20
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 93 450 3.0E-20
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 719 1073 3.0E-20
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 113 461 3.0E-20
sp|Q12181|NDOR1_YEAST NADPH-dependent diflavin oxidoreductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAH18 PE=1 SV=1 512 1067 4.0E-20
sp|P39692|MET10_YEAST Sulfite reductase [NADPH] flavoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET10 PE=1 SV=2 676 1028 4.0E-20
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 155 443 4.0E-20
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 6 443 5.0E-20
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 5 460 5.0E-20
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 118 467 5.0E-20
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 101 449 6.0E-20
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 61 440 6.0E-20
sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 3 440 7.0E-20
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 55 443 7.0E-20
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 512 1059 7.0E-20
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 5 425 8.0E-20
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 7 472 8.0E-20
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 82 440 1.0E-19
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 690 1072 1.0E-19
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 112 440 1.0E-19
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 112 440 1.0E-19
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 101 440 2.0E-19
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 211 460 2.0E-19
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 72 461 2.0E-19
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 111 474 2.0E-19
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 113 442 2.0E-19
sp|Q9V6H1|CP9H1_DROME Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 113 440 3.0E-19
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 112 482 3.0E-19
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 132 453 3.0E-19
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 152 462 4.0E-19
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 156 440 4.0E-19
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 48 469 4.0E-19
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 112 449 4.0E-19
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 157 436 6.0E-19
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 232 443 6.0E-19
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 258 471 7.0E-19
sp|Q09878|MET10_SCHPO Probable sulfite reductase [NADPH] flavoprotein component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.01c PE=3 SV=2 686 1028 7.0E-19
sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 100 463 8.0E-19
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 156 428 8.0E-19
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 229 461 9.0E-19
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 229 461 9.0E-19
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 266 480 1.0E-18
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 47 441 1.0E-18
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 266 440 1.0E-18
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 158 462 1.0E-18
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 238 440 1.0E-18
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 216 459 1.0E-18
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 109 469 2.0E-18
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 262 471 2.0E-18
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 510 1064 2.0E-18
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 5 440 2.0E-18
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 248 442 2.0E-18
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 1 440 2.0E-18
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 258 466 2.0E-18
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 87 441 3.0E-18
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 111 453 3.0E-18
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 2 471 3.0E-18
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 238 463 3.0E-18
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 512 1043 3.0E-18
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 193 459 4.0E-18
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 205 464 4.0E-18
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 205 464 4.0E-18
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 205 464 4.0E-18
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 266 470 4.0E-18
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 6 466 6.0E-18
sp|Q6CVG8|NDOR1_KLULA NADPH-dependent diflavin oxidoreductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAH18 PE=3 SV=1 512 1072 8.0E-18
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 99 440 8.0E-18
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 101 449 8.0E-18
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 113 461 1.0E-17
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 5 442 1.0E-17
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 48 442 1.0E-17
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 262 463 1.0E-17
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 247 471 2.0E-17
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 107 439 2.0E-17
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 100 463 2.0E-17
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 6 448 2.0E-17
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 223 440 2.0E-17
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 5 443 2.0E-17
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 262 460 3.0E-17
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 5 440 3.0E-17
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 82 440 4.0E-17
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 211 446 4.0E-17
sp|Q9VJ71|CP310_DROME Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 120 442 4.0E-17
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 113 440 5.0E-17
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 232 457 5.0E-17
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 261 471 5.0E-17
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 6 448 6.0E-17
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 5 460 6.0E-17
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 6 442 6.0E-17
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 229 443 6.0E-17
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 6 442 6.0E-17
sp|Q6FRH1|NDOR1_CANGA NADPH-dependent diflavin oxidoreductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TAH18 PE=3 SV=1 512 1061 6.0E-17
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 112 482 6.0E-17
sp|Q9V4I0|CP9B1_DROME Cytochrome P450 9b1 OS=Drosophila melanogaster GN=Cyp9b1 PE=2 SV=1 12 429 7.0E-17
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 261 467 7.0E-17
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 107 467 8.0E-17
sp|Q9V774|C6A21_DROME Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 113 443 9.0E-17
sp|P9WPP9|CP51_MYCTU Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 139 442 9.0E-17
sp|P9WPP8|CP51_MYCTO Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 139 442 9.0E-17
sp|P0A513|CP51_MYCBO Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 139 442 9.0E-17
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 248 477 1.0E-16
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 248 442 1.0E-16
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 48 440 1.0E-16
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 139 472 1.0E-16
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 113 461 1.0E-16
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 156 460 1.0E-16
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 111 443 1.0E-16
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 50 442 1.0E-16
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 264 440 1.0E-16
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 512 1072 2.0E-16
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 512 1072 2.0E-16
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 220 442 2.0E-16
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 268 444 2.0E-16
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 2 443 2.0E-16
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 29 440 2.0E-16
sp|P9WPN1|C135A_MYCTU Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 25 448 2.0E-16
sp|P9WPN0|C135A_MYCTO Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 25 448 2.0E-16
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 261 467 2.0E-16
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 5 443 2.0E-16
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 6 440 3.0E-16
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 259 440 3.0E-16
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 6 443 3.0E-16
sp|Q69FB6|CP19A_LAGAC Aromatase OS=Lagenorhynchus acutus GN=CYP19A1 PE=2 SV=1 220 462 3.0E-16
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 512 1037 3.0E-16
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 48 440 3.0E-16
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 246 462 4.0E-16
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 6 440 4.0E-16
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 264 461 4.0E-16
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 137 442 5.0E-16
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 152 462 5.0E-16
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 156 443 5.0E-16
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 113 440 5.0E-16
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 119 444 6.0E-16
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 48 440 6.0E-16
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 2 468 6.0E-16
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 113 443 6.0E-16
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 203 461 6.0E-16
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 5 456 6.0E-16
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 247 440 7.0E-16
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 261 471 7.0E-16
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 2 461 7.0E-16
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 214 442 8.0E-16
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 48 440 9.0E-16
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 113 461 1.0E-15
sp|Q9V4I1|CP9B2_DROME Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 12 429 1.0E-15
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 137 440 1.0E-15
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 5 440 1.0E-15
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 6 442 1.0E-15
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 229 442 1.0E-15
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 211 440 1.0E-15
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 6 464 1.0E-15
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 229 462 1.0E-15
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 111 440 1.0E-15
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 64 461 1.0E-15
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 220 440 1.0E-15
sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 100 440 2.0E-15
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 82 460 2.0E-15
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 249 453 2.0E-15
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 6 440 2.0E-15
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 231 471 2.0E-15
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 221 440 2.0E-15
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 140 447 2.0E-15
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 221 440 2.0E-15
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 221 440 2.0E-15
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 128 442 2.0E-15
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 6 443 2.0E-15
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 113 441 3.0E-15
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 220 440 3.0E-15
sp|Q9XS28|CP19A_SHEEP Aromatase OS=Ovis aries GN=CYP19A1 PE=2 SV=1 220 462 3.0E-15
sp|Q6YI21|CP19A_CAPHI Aromatase OS=Capra hircus GN=CYP19A1 PE=2 SV=1 220 462 3.0E-15
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 249 459 3.0E-15
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 258 480 4.0E-15
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 4 440 4.0E-15
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 229 440 4.0E-15
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 107 442 4.0E-15
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 6 443 4.0E-15
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 156 459 4.0E-15
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 6 453 4.0E-15
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 6 443 5.0E-15
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 5 442 5.0E-15
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 5 440 5.0E-15
sp|Q5QQX7|CP19A_CANLF Aromatase OS=Canis lupus familiaris GN=CYP19A1 PE=2 SV=1 220 462 5.0E-15
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 213 454 6.0E-15
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 6 469 7.0E-15
sp|P46194|CP19A_BOVIN Aromatase OS=Bos taurus GN=CYP19A1 PE=2 SV=3 220 462 7.0E-15
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 113 462 7.0E-15
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 220 440 7.0E-15
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 6 442 8.0E-15
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 207 442 8.0E-15
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 263 457 9.0E-15
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 257 440 9.0E-15
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 6 453 9.0E-15
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 262 461 9.0E-15
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 5 442 1.0E-14
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 249 442 1.0E-14
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 220 440 1.0E-14
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 183 442 1.0E-14
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 6 442 1.0E-14
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 214 440 1.0E-14
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 236 440 1.0E-14
sp|Q9FLC8|C79A2_ARATH Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 232 440 1.0E-14
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 198 440 1.0E-14
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 221 440 1.0E-14
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 207 440 1.0E-14
sp|Q54E98|C520B_DICDI Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 3 464 1.0E-14
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 213 421 2.0E-14
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 48 440 2.0E-14
sp|Q9M7B8|C79D1_MANES Valine N-monooxygenase 1 OS=Manihot esculenta GN=CYP79D1 PE=1 SV=1 248 457 2.0E-14
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 6 440 2.0E-14
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 221 440 2.0E-14
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 263 457 2.0E-14
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 151 442 2.0E-14
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 229 442 2.0E-14
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 6 442 2.0E-14
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 231 443 2.0E-14
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 259 424 2.0E-14
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 252 461 2.0E-14
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 211 454 2.0E-14
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 223 440 3.0E-14
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 2 440 3.0E-14
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 156 425 3.0E-14
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 6 462 3.0E-14
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 6 471 3.0E-14
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 6 442 3.0E-14
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 6 442 3.0E-14
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 102 436 3.0E-14
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 6 444 3.0E-14
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 113 462 3.0E-14
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 261 471 3.0E-14
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 210 440 3.0E-14
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 6 440 3.0E-14
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 216 442 3.0E-14
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 6 447 3.0E-14
sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 247 443 4.0E-14
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 6 458 4.0E-14
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 6 442 4.0E-14
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 6 442 4.0E-14
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 6 440 5.0E-14
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 3 440 5.0E-14
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 6 442 5.0E-14
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 265 442 5.0E-14
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 281 462 5.0E-14
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 223 442 5.0E-14
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 126 441 5.0E-14
sp|Q95M61|CP19A_CALJA Aromatase OS=Callithrix jacchus GN=CYP19A1 PE=2 SV=2 91 463 5.0E-14
sp|P79430|CP192_PIG Aromatase 2 OS=Sus scrofa GN=CYP19A2 PE=2 SV=1 209 462 6.0E-14
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 123 443 6.0E-14
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 1 471 6.0E-14
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 512 687 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005506 iron ion binding Yes
GO:0046914 transition metal ion binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6855
MPKDIPAPGGLPIVGNALQIDSEQPQESLARFSEIYGKQRLKSQFQRLRLTHRIGPIFKLRVPEPRIFFANYALV
QDLFDEKRFQKNVGAGLKQVRNATRDGLFTAFPEEPSWAIAHRILMPAFGPLAIRAMFAEMKDISAQMILKLARF
GPDHLISVSDEFTNLTLDSIALCAMGTRFNSFYHDEPHRFVSAMTGVLSESAARSKRPSLIGKLHKESNRKYKED
IETLESISKEMLQNRRQHPTDDQDLLNAMINGKDPKTGQKLRDETIIANMITFLIAGHETTSGLLSFLFYELLQS
PEALKEATKEVDNVIGTAPVTVEHMSKLPYIEACLRETLRLHPTAPAFSLEAKGDQLINGEYLIKDKQACVVLLM
RLHRDPEVFGSDAEEFRPSRMYGENFTKLPPNCWKPFGNGSRGCIGRPFAWQEAILAVAMLLQTFHFSKGSASYQ
LKIKSTLTIKPDNFYMRARLRDPKRLESLTQLGPETKSGAEDRESKNKAGATNKEGLTPLWVLYGSNTGTCEALA
QSLACSAPDHGFKAEVKDLDSAPSALSAEIPAVIITASYEGQPPDNAGHFVEGLKTASKDESKGVNFAVFGVGNK
EWKETYQKIPIVIDEALVKAGANQLAPRASVDVAQGNIFDALYDWQDKSLWPALSKLYGKKDEADNDGELGALNL
EIGTQTRSKLLRQDVVTAEVSESRLLTRQGAAARKRHIVVNLPSGLSYRAGDYLAVLPVNPSENVRRVMKRFQLP
WDATITIDEKRPTSLPTGKAINVSSTLSTMVELSQPVSNRVAIGLAKTIPEEKLVKELEARAAEEDFQADNVTLL
DLLEDYPTANFSFGQFLAAVPPMRIRQYSISSTPLSSPYHCSLTYSVVDAPARGSRHGHRFLGVASSYMERLEVG
ERIQISIRPSRNGFHLPTDDSKPIIMACAGTGLAPFRAFVAERALKKSGGREVGPALLFYGCSRPEDDDLYRDEL
DKWEAEGAVRVRRAYSKQPDASEGCKYVQDRLWLDREHVRELYAKGAQLYCCGAGAVGSAVEDTMVRIKADVAGC
DTETAYKWVQERKGDRYYSDIFS*
Coding >Ophun1|6855
ATGCCAAAGGACATTCCAGCACCGGGGGGCCTCCCCATCGTCGGAAACGCCCTCCAGATTGACTCGGAGCAACCA
CAGGAGAGTCTCGCCCGCTTCTCCGAAATCTACGGTAAACAAAGACTCAAGTCCCAGTTCCAGCGCCTCCGGCTG
ACGCACCGCATAGGGCCCATCTTCAAGCTCCGCGTGCCGGAGCCTCGCATCTTCTTCGCCAACTATGCCCTCGTG
CAGGACCTCTTTGACGAAAAACGGTTTCAGAAGAATGTCGGCGCTGGGCTGAAGCAGGTTCGGAACGCGACTCGT
GATGGCCTCTTCACTGCTTTCCCCGAGGAGCCGAGTTGGGCGATTGCCCATCGGATTCTCATGCCTGCTTTTGGC
CCGCTGGCTATTAGGGCTATGTTTGCGGAGATGAAGGATATCTCTGCGCAGATGATACTCAAGCTGGCTCGCTTT
GGGCCGGATCATCTGATAAGTGTCTCGGACGAGTTTACGAATCTCACCCTGGACTCGATTGCTCTGTGCGCCATG
GGAACGAGGTTCAACTCGTTTTACCACGACGAGCCTCATCGCTTCGTCTCGGCCATGACGGGCGTTCTCTCCGAA
TCAGCCGCTCGCTCTAAGCGTCCATCGCTGATTGGAAAGCTCCACAAGGAGAGTAACAGGAAGTACAAGGAAGAC
ATCGAGACGCTGGAGAGTATATCCAAGGAGATGCTGCAGAACCGCAGGCAGCATCCCACCGATGACCAGGACCTG
CTCAACGCCATGATCAACGGCAAGGATCCCAAGACGGGCCAGAAGCTGCGTGACGAGACCATCATTGCCAACATG
ATTACCTTTTTGATCGCTGGTCATGAAACCACTTCCGGTCTCTTATCCTTCCTCTTCTACGAGCTGCTGCAGAGC
CCAGAGGCCCTCAAAGAGGCGACAAAGGAGGTGGACAACGTCATTGGCACAGCGCCCGTCACCGTCGAGCACATG
TCCAAGCTTCCCTACATCGAAGCCTGCCTACGCGAAACACTGCGTCTGCATCCAACCGCTCCCGCCTTCTCCCTC
GAGGCCAAGGGCGACCAGCTCATAAATGGAGAGTATCTCATCAAGGATAAACAGGCCTGTGTGGTTCTCTTGATG
CGCCTCCACCGGGATCCCGAAGTCTTTGGGTCCGACGCAGAAGAGTTTAGGCCGTCGCGGATGTATGGAGAGAAC
TTTACTAAACTGCCGCCCAACTGCTGGAAGCCATTCGGAAACGGATCTCGCGGCTGCATAGGAAGACCATTCGCG
TGGCAAGAAGCAATCCTCGCCGTAGCAATGCTCCTCCAAACATTCCACTTCTCCAAAGGCAGCGCCTCATACCAG
CTCAAGATCAAGTCTACGCTTACCATCAAGCCGGATAACTTCTACATGCGCGCCCGACTGCGTGACCCGAAGCGG
CTGGAAAGCCTGACGCAGCTCGGACCGGAGACCAAGTCCGGAGCCGAGGACCGGGAGTCGAAGAACAAGGCCGGG
GCAACGAATAAGGAGGGTCTAACGCCACTTTGGGTCCTGTACGGGTCTAACACGGGGACGTGTGAGGCGCTGGCG
CAGTCGCTGGCTTGTTCTGCTCCGGATCATGGATTCAAGGCCGAGGTCAAGGATCTGGATAGCGCTCCGTCGGCG
CTCTCGGCTGAGATTCCCGCTGTCATCATCACGGCTAGTTACGAAGGACAGCCACCCGATAATGCCGGCCACTTT
GTCGAGGGTCTCAAGACGGCGTCTAAGGACGAGAGCAAGGGAGTCAACTTTGCCGTCTTTGGAGTTGGAAACAAG
GAGTGGAAAGAAACATACCAGAAAATCCCCATCGTCATCGACGAAGCCCTCGTCAAAGCCGGCGCCAACCAGCTC
GCACCTCGAGCATCCGTCGACGTAGCCCAAGGCAACATCTTCGACGCCCTATACGACTGGCAAGACAAGTCGCTA
TGGCCCGCTCTCAGCAAACTCTACGGCAAGAAAGACGAAGCCGACAACGACGGCGAGCTTGGGGCTCTTAACCTT
GAGATTGGGACGCAGACGCGGTCCAAGCTGCTGCGGCAGGACGTTGTTACCGCTGAGGTCAGTGAGTCGAGGCTG
TTGACGAGACAAGGGGCGGCAGCGAGGAAACGCCACATCGTCGTCAACCTCCCCTCTGGATTGTCGTACCGCGCA
GGAGATTATCTAGCCGTCTTGCCCGTCAACCCCTCGGAGAACGTACGACGCGTCATGAAACGCTTCCAGCTCCCC
TGGGACGCAACCATCACCATCGACGAGAAAAGACCAACTTCCCTTCCCACGGGCAAAGCCATCAACGTTTCTTCC
ACCCTCAGCACCATGGTGGAACTCAGCCAGCCCGTATCCAACCGAGTGGCCATCGGACTGGCCAAGACGATACCA
GAAGAGAAGCTCGTCAAGGAGCTGGAAGCACGGGCAGCAGAAGAGGACTTTCAAGCGGACAACGTCACGCTGCTC
GATCTCCTCGAAGACTACCCAACCGCAAACTTTTCCTTTGGCCAGTTCCTCGCAGCCGTACCGCCAATGCGAATC
AGACAGTACAGCATCTCGTCAACGCCCCTATCGTCCCCTTACCACTGCTCCCTGACATACAGCGTCGTCGACGCC
CCCGCCAGAGGCAGCCGCCACGGCCACCGCTTCCTCGGCGTAGCGAGCTCCTACATGGAACGGCTAGAAGTCGGG
GAACGAATCCAGATCAGCATCCGTCCGAGCCGCAACGGCTTCCACCTCCCCACCGACGACTCCAAGCCCATCATC
ATGGCCTGCGCCGGTACGGGCCTGGCTCCCTTCCGGGCTTTCGTGGCTGAGCGGGCGCTGAAGAAGAGTGGTGGG
AGGGAGGTCGGGCCCGCGCTGCTTTTCTACGGGTGCTCTCGGCCTGAGGATGATGATTTGTATCGTGACGAGCTT
GACAAGTGGGAGGCTGAAGGTGCTGTGCGCGTCCGTCGTGCCTATTCGAAGCAGCCGGATGCGTCGGAGGGATGC
AAGTACGTGCAGGATCGGCTCTGGCTTGATCGTGAGCATGTCAGGGAGCTGTATGCCAAGGGAGCGCAGCTTTAC
TGCTGTGGAGCGGGGGCTGTGGGCTCGGCGGTTGAGGATACCATGGTTCGCATCAAGGCTGATGTTGCGGGCTGT
GATACGGAGACTGCTTACAAGTGGGTGCAGGAGAGGAAGGGGGATCGGTATTATTCCGATATTTTCTCGTAG
Transcript >Ophun1|6855
ATGCCAAAGGACATTCCAGCACCGGGGGGCCTCCCCATCGTCGGAAACGCCCTCCAGATTGACTCGGAGCAACCA
CAGGAGAGTCTCGCCCGCTTCTCCGAAATCTACGGTAAACAAAGACTCAAGTCCCAGTTCCAGCGCCTCCGGCTG
ACGCACCGCATAGGGCCCATCTTCAAGCTCCGCGTGCCGGAGCCTCGCATCTTCTTCGCCAACTATGCCCTCGTG
CAGGACCTCTTTGACGAAAAACGGTTTCAGAAGAATGTCGGCGCTGGGCTGAAGCAGGTTCGGAACGCGACTCGT
GATGGCCTCTTCACTGCTTTCCCCGAGGAGCCGAGTTGGGCGATTGCCCATCGGATTCTCATGCCTGCTTTTGGC
CCGCTGGCTATTAGGGCTATGTTTGCGGAGATGAAGGATATCTCTGCGCAGATGATACTCAAGCTGGCTCGCTTT
GGGCCGGATCATCTGATAAGTGTCTCGGACGAGTTTACGAATCTCACCCTGGACTCGATTGCTCTGTGCGCCATG
GGAACGAGGTTCAACTCGTTTTACCACGACGAGCCTCATCGCTTCGTCTCGGCCATGACGGGCGTTCTCTCCGAA
TCAGCCGCTCGCTCTAAGCGTCCATCGCTGATTGGAAAGCTCCACAAGGAGAGTAACAGGAAGTACAAGGAAGAC
ATCGAGACGCTGGAGAGTATATCCAAGGAGATGCTGCAGAACCGCAGGCAGCATCCCACCGATGACCAGGACCTG
CTCAACGCCATGATCAACGGCAAGGATCCCAAGACGGGCCAGAAGCTGCGTGACGAGACCATCATTGCCAACATG
ATTACCTTTTTGATCGCTGGTCATGAAACCACTTCCGGTCTCTTATCCTTCCTCTTCTACGAGCTGCTGCAGAGC
CCAGAGGCCCTCAAAGAGGCGACAAAGGAGGTGGACAACGTCATTGGCACAGCGCCCGTCACCGTCGAGCACATG
TCCAAGCTTCCCTACATCGAAGCCTGCCTACGCGAAACACTGCGTCTGCATCCAACCGCTCCCGCCTTCTCCCTC
GAGGCCAAGGGCGACCAGCTCATAAATGGAGAGTATCTCATCAAGGATAAACAGGCCTGTGTGGTTCTCTTGATG
CGCCTCCACCGGGATCCCGAAGTCTTTGGGTCCGACGCAGAAGAGTTTAGGCCGTCGCGGATGTATGGAGAGAAC
TTTACTAAACTGCCGCCCAACTGCTGGAAGCCATTCGGAAACGGATCTCGCGGCTGCATAGGAAGACCATTCGCG
TGGCAAGAAGCAATCCTCGCCGTAGCAATGCTCCTCCAAACATTCCACTTCTCCAAAGGCAGCGCCTCATACCAG
CTCAAGATCAAGTCTACGCTTACCATCAAGCCGGATAACTTCTACATGCGCGCCCGACTGCGTGACCCGAAGCGG
CTGGAAAGCCTGACGCAGCTCGGACCGGAGACCAAGTCCGGAGCCGAGGACCGGGAGTCGAAGAACAAGGCCGGG
GCAACGAATAAGGAGGGTCTAACGCCACTTTGGGTCCTGTACGGGTCTAACACGGGGACGTGTGAGGCGCTGGCG
CAGTCGCTGGCTTGTTCTGCTCCGGATCATGGATTCAAGGCCGAGGTCAAGGATCTGGATAGCGCTCCGTCGGCG
CTCTCGGCTGAGATTCCCGCTGTCATCATCACGGCTAGTTACGAAGGACAGCCACCCGATAATGCCGGCCACTTT
GTCGAGGGTCTCAAGACGGCGTCTAAGGACGAGAGCAAGGGAGTCAACTTTGCCGTCTTTGGAGTTGGAAACAAG
GAGTGGAAAGAAACATACCAGAAAATCCCCATCGTCATCGACGAAGCCCTCGTCAAAGCCGGCGCCAACCAGCTC
GCACCTCGAGCATCCGTCGACGTAGCCCAAGGCAACATCTTCGACGCCCTATACGACTGGCAAGACAAGTCGCTA
TGGCCCGCTCTCAGCAAACTCTACGGCAAGAAAGACGAAGCCGACAACGACGGCGAGCTTGGGGCTCTTAACCTT
GAGATTGGGACGCAGACGCGGTCCAAGCTGCTGCGGCAGGACGTTGTTACCGCTGAGGTCAGTGAGTCGAGGCTG
TTGACGAGACAAGGGGCGGCAGCGAGGAAACGCCACATCGTCGTCAACCTCCCCTCTGGATTGTCGTACCGCGCA
GGAGATTATCTAGCCGTCTTGCCCGTCAACCCCTCGGAGAACGTACGACGCGTCATGAAACGCTTCCAGCTCCCC
TGGGACGCAACCATCACCATCGACGAGAAAAGACCAACTTCCCTTCCCACGGGCAAAGCCATCAACGTTTCTTCC
ACCCTCAGCACCATGGTGGAACTCAGCCAGCCCGTATCCAACCGAGTGGCCATCGGACTGGCCAAGACGATACCA
GAAGAGAAGCTCGTCAAGGAGCTGGAAGCACGGGCAGCAGAAGAGGACTTTCAAGCGGACAACGTCACGCTGCTC
GATCTCCTCGAAGACTACCCAACCGCAAACTTTTCCTTTGGCCAGTTCCTCGCAGCCGTACCGCCAATGCGAATC
AGACAGTACAGCATCTCGTCAACGCCCCTATCGTCCCCTTACCACTGCTCCCTGACATACAGCGTCGTCGACGCC
CCCGCCAGAGGCAGCCGCCACGGCCACCGCTTCCTCGGCGTAGCGAGCTCCTACATGGAACGGCTAGAAGTCGGG
GAACGAATCCAGATCAGCATCCGTCCGAGCCGCAACGGCTTCCACCTCCCCACCGACGACTCCAAGCCCATCATC
ATGGCCTGCGCCGGTACGGGCCTGGCTCCCTTCCGGGCTTTCGTGGCTGAGCGGGCGCTGAAGAAGAGTGGTGGG
AGGGAGGTCGGGCCCGCGCTGCTTTTCTACGGGTGCTCTCGGCCTGAGGATGATGATTTGTATCGTGACGAGCTT
GACAAGTGGGAGGCTGAAGGTGCTGTGCGCGTCCGTCGTGCCTATTCGAAGCAGCCGGATGCGTCGGAGGGATGC
AAGTACGTGCAGGATCGGCTCTGGCTTGATCGTGAGCATGTCAGGGAGCTGTATGCCAAGGGAGCGCAGCTTTAC
TGCTGTGGAGCGGGGGCTGTGGGCTCGGCGGTTGAGGATACCATGGTTCGCATCAAGGCTGATGTTGCGGGCTGT
GATACGGAGACTGCTTACAAGTGGGTGCAGGAGAGGAAGGGGGATCGGTATTATTCCGATATTTTCTCGTAG
Gene >Ophun1|6855
ATGCCAAAGGACATTCCAGCACCGGGGGGCCTCCCCATCGTCGGAAACGCCCTCCAGATTGACTCGGAGCAACCA
CAGGAGAGTCTCGCCCGCTTCTCCGAAATCTACGGTAAACAAAGACTCAAGTCCCAGTTCCAGCGCCTCCGGCTG
ACGCACCGCATAGGGCCCATCTTCAAGCTCCGCGTGCCGGAGCCTCGCATCTTCTTCGCCAACTATGCCCTCGTG
CAGGACCTCTTTGACGAAAAACGGTTTCAGAAGAATGTCGGCGCTGGGCTGAAGCAGGTTCGGAACGCGACTCGT
GATGGCCTCTTCACTGCTTTCCCCGAGGAGCCGAGTTGGGCGATTGCCCATCGGATTCTCATGCCTGCTTTTGGC
CCGCTGGCTATTAGGGCTATGTTTGCGGAGATGAAGGATATCTCTGCGCAGATGATACTCAAGCTGGCTCGCTTT
GGGCCGGATCATCTGATAAGTGTCTCGGACGAGTTTACGAATCTCACCCTGGACTCGATTGCTCTGTAAGTCATG
AAGCTCAATGGGAGTTTTTCCGGACAGCAGCTTATTGAATCCAAGGTGCGCCATGGGAACGAGGTTCAACTCGTT
TTACCACGACGAGCCTCATCGCTTCGTCTCGGCCATGACGGGCGTTCTCTCCGAATCAGCCGCTCGCTCTAAGCG
TCCATCGCTGATTGGAAAGCTCCACAAGGAGAGTAACAGGAAGTACAAGGAAGACATCGAGACGCTGGAGAGTAT
ATCCAAGGAGATGCTGCAGAACCGCAGGCAGCATCCCACCGATGACCAGGACCTGCTCAACGCCATGATCAACGG
CAAGGATCCCAAGACGGGCCAGAAGCTGCGTGACGAGACCATCATTGCCAACATGATTACCTTTTTGATCGCTGG
TGAGCTCGCCGTCGGTCGCATGTGTGGACTGAGTCTGATTCTAGGGATTCAGGTCATGAAACCACTTCCGGTCTC
TTATCCTTCCTCTTCTACGAGCTGCTGCAGAGCCCAGAGGCCCTCAAAGAGGCGACAAAGGAGGTGGACAACGTC
ATTGGCACAGCGCCCGTCACCGTCGAGCACATGTCCAAGCTTCCCTACATCGAAGCCTGCCTACGCGGTAAGTCT
CTCTTCTAAACGTCAACTCTGAGCATGAAACCCTGACGACTCGAAGAAACACTGCGTCTGCATCCAACCGCTCCC
GCCTTCTCCCTCGAGGCCAAGGGCGACCAGCTCATAAATGGAGAGTATCTCATCAAGGATAAACAGGCCTGTGTG
GTTCTCTTGATGCGCCTCCACCGGGATCCCGAAGTCTTTGGGTCCGACGCAGAAGAGTTTAGGCCGTCGCGGATG
TATGGAGAGAACTTTACTAAACTGCCGCCCAACTGCTGGAAGGTGAGTTGTCTTGAATAACCCAAGTCATCCTTC
AAATTCTCCCGGCTAACCCCCGTCGAAGCCATTCGGAAACGGATCTCGCGGCTGCATAGGAAGACCATTCGCGTG
GCAAGAAGCAATCCTCGCCGTAGCAATGCTCCTCCAAACATTCCACTTCTCCAAAGGCAGCGCCTCATACCAGCT
CAAGATCAAGTCTACGCTTACCATCAAGCCGGATAACTTCTACATGCGCGCCCGACTGCGTGACCCGAAGCGGCT
GGAAAGCCTGACGCAGCTCGGACCGGAGACCAAGTCCGGAGCCGAGGACCGGGAGTCGAAGAACAAGGCCGGGGC
AACGAATAAGGAGGGTCTAACGCCACTTTGGGTCCTGTACGGGTCTAACACGGGGACGTGTGAGGCGCTGGCGCA
GTCGCTGGCTTGTTCTGCTCCGGATCATGGATTCAAGGCCGAGGTCAAGGATCTGGATAGCGCTCCGTCGGCGCT
CTCGGCTGAGATTCCCGCTGTCATCATCACGGCTAGTTACGAAGGACAGCCACCCGATAATGCCGGCCACTTTGT
CGAGGGTCTCAAGACGGCGTCTAAGGACGAGAGCAAGGGAGTCAACTTTGCCGTCTTTGGAGTTGGAAACAGTCC
GTCGCCCAATCTTCTTCCGAGCTCATAACTCGAGATGCTAACGCTCGGACAGAGGAGTGGAAAGAAACATACCAG
AAAATCCCCATCGTCATCGACGAAGCCCTCGTCAAAGCCGGCGCCAACCAGCTCGCACCTCGAGCATCCGTCGAC
GTAGCCCAAGGCAACATCTTCGACGCCCTATACGACTGGCAAGACAAGTCGCTATGGCCCGCTCTCAGCAAACTC
TACGGCAAGAAAGACGAAGCCGACAACGACGGCGAGCTTGGGGCTCTTAACCTTGAGATTGGGACGCAGACGCGG
TCCAAGCTGCTGCGGCAGGACGTTGTTACCGCTGAGGTCAGTGAGTCGAGGCTGTTGACGAGACAAGGGGCGGCA
GCGAGGAAACGCCACATCGTCGTCAACCTCCCCTCTGGATTGTCGTACCGCGCAGGAGATTATCTAGCCGTCTTG
CCCGTCAACCCCTCGGAGAACGTACGACGCGTCATGAAACGCTTCCAGCTCCCCTGGGACGCAACCATCACCATC
GACGAGAAAAGACCAACTTCCCTTCCCACGGGCAAAGCCATCAACGTTTCTTCCACCCTCAGCACCATGGTGGAA
CTCAGCCAGCCCGTATCCAACCGAGTGGCCATCGGACTGGCCAAGACGATACCAGAAGAGAAGCTCGTCAAGGAG
CTGGAAGCACGGGCAGCAGAAGAGGACTTTCAAGCGGACAACGTCACGCTGCTCGATCTCCTCGAAGACTACCCA
ACCGCAAACTTTTCCTTTGGCCAGTTCCTCGCAGCCGTACCGCCAATGCGAATCAGACAGTACAGCATCTCGTCA
ACGCCCCTATCGTCCCCTTACCACTGCTCCCTGACATACAGCGTCGTCGACGCCCCCGCCAGAGGCAGCCGCCAC
GGCCACCGCTTCCTCGGCGTAGCGAGCTCCTACATGGAACGGCTAGAAGTCGGGGAACGAATCCAGATCAGCATC
CGTCCGAGCCGCAACGGCTTCCACCTCCCCACCGACGACTCCAAGCCCATCATCATGGCCTGCGCCGGTACGGGC
CTGGCTCCCTTCCGGGCTTTCGTGGCTGAGCGGGCGCTGAAGAAGAGTGGTGGGAGGGAGGTCGGGCCCGCGCTG
CTTTTCTACGGGTGCTCTCGGCCTGAGGATGATGATTTGTATCGTGACGAGCTTGACAAGTGGGAGGCTGAAGGT
GCTGTGCGCGTCCGTCGTGCCTATTCGAAGCAGCCGGATGCGTCGGAGGGATGCAAGTACGTGCAGGATCGGCTC
TGGCTTGATCGTGAGCATGTCAGGGAGCTGTATGCCAAGGGAGCGCAGCTTTACTGCTGTGGAGCGGGGGCTGTG
GGCTCGGCGGTTGAGGATACCATGGTTCGCATCAAGGCTGATGTTGCGGGCTGTGATACGGAGACTGCTTACAAG
TGGGTGCAGGAGAGGAAGGGGGATCGGTATTATTCCGATATTTTCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail