Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6851
Gene name
LocationContig_79:19149..21480
Strand-
Gene length (bp)2331
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10261 Scs3p Inositol phospholipid synthesis and fat-storage-inducing TM 8.7E-68 69 276
PF19327 Ap4A_phos_N Ap4A phosphorylase N-terminal domain 1.6E-27 323 449
PF09830 ATP_transf ATP adenylyltransferase C-terminal domain 2.6E-20 476 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 69 273 6.0E-30
sp|P49348|APA2_KLULA Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=APA2 PE=3 SV=1 296 583 1.0E-23
sp|P22108|APA2_YEAST Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APA2 PE=1 SV=1 335 587 3.0E-22
sp|P16550|APA1_YEAST Protein APA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APA1 PE=1 SV=4 331 587 6.0E-22
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 70 276 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM4|SCS3_SCHPO FIT family protein scs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scs3 PE=3 SV=1 69 273 6.0E-30
sp|P49348|APA2_KLULA Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=APA2 PE=3 SV=1 296 583 1.0E-23
sp|P22108|APA2_YEAST Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APA2 PE=1 SV=1 335 587 3.0E-22
sp|P16550|APA1_YEAST Protein APA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APA1 PE=1 SV=4 331 587 6.0E-22
sp|Q9VRJ2|FITM_DROME FIT family protein CG10671 OS=Drosophila melanogaster GN=CG10671 PE=1 SV=1 70 276 2.0E-12
sp|A4IFN5|FITM2_BOVIN Fat storage-inducing transmembrane protein 2 OS=Bos taurus GN=FITM2 PE=2 SV=1 70 277 4.0E-12
sp|B2LYG4|FITM2_PIG Fat storage-inducing transmembrane protein 2 OS=Sus scrofa GN=FITM2 PE=2 SV=1 70 277 1.0E-11
sp|P59266|FITM2_MOUSE Fat storage-inducing transmembrane protein 2 OS=Mus musculus GN=Fitm2 PE=1 SV=1 70 277 2.0E-11
sp|Q8N6M3|FITM2_HUMAN Fat storage-inducing transmembrane protein 2 OS=Homo sapiens GN=FITM2 PE=2 SV=1 70 277 3.0E-10
sp|Q52KL1|FITM2_DANRE Fat storage-inducing transmembrane protein 2 OS=Danio rerio GN=fitm2 PE=2 SV=1 70 276 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003877 ATP adenylyltransferase activity Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0019915 lipid storage Yes
GO:0051179 localization No
GO:0070566 adenylyltransferase activity No
GO:0031090 organelle membrane No
GO:0003674 molecular_function No
GO:0016020 membrane No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0051235 maintenance of location No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 82 104 22
3 119 141 22
4 240 262 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6851
MAPSPRAGGGTAAPRHSPYLPTPLERLTVSVFPLMLIFGAIFSLLSPETRSAPYYAGEQAHAQTANEAPSYFARK
ANVFNVVFVKRGWAWTTFAFFFFIVTRGVTDKRRLQAGLRWVGATAWWVLVTQWCFGPPLIDRGFLWTGGKCEGR
KDDMITAVACKAAGGRWRGGHDISGHVFLLVLGSLFLGQEVGWPLLRAARLRADERCVVMADGAVKGAGVESDGE
QTSTEQGLGPAAKTTIVVVGLKLWMLLMTAIYFHTWIEKFTGLVTALVGGYGLLAPQHQQATTMSRAIKAPKGLP
ELVDLTFRNCRTSQDVIHHPSTVGLFHAGLIPFQIRFCPALAKMPKPVKESSRPVDPFANPPERLCLGDVGPGHY
LVLNKFPILDGHFILATKQFEPQGSLLDVADFEAALACVKAYEHVDGGLFVFFNSGEHSGASQPHRHLQMLPMKS
MRLDQDGDGKVPSWEPLITRSSLLESAPFVTFSQDIQSDVSPEKVRTTYLNLYRKACNSLGIDAEDQTEGEARIS
YNLGLTAERLVVCPRRAEGDEEGMLSLNGTVLAGTALVKSEEVWRALTEGPELLEGVLRKIGVERIGS*
Coding >Ophun1|6851
ATGGCACCGTCACCGCGCGCCGGCGGAGGCACAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCGTCTTTCCCTTGATGCTCATCTTCGGCGCCATCTTCTCGCTGCTCTCTCCCGAGACGCGC
TCAGCTCCCTACTACGCCGGCGAGCAGGCTCACGCGCAGACAGCCAACGAAGCGCCCAGCTACTTCGCCCGCAAA
GCCAACGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTGCCTTCTTCTTCTTCATCGTT
ACGAGGGGCGTCACCGATAAGCGCAGGTTGCAGGCGGGTCTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCGCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGGCCGC
AAGGACGACATGATTACCGCCGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGACATCTCGGGG
CATGTCTTCCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTGTTGCGAGCTGCTCGT
CTGAGGGCGGATGAGAGGTGTGTCGTCATGGCAGACGGGGCCGTCAAGGGCGCAGGCGTCGAGTCGGATGGGGAA
CAGACGTCGACGGAGCAGGGGCTTGGACCGGCAGCCAAGACGACCATTGTGGTTGTTGGCCTGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGATCGAAAAGTTTACCGGTCTGGTGACGGCGCTGGTGGGAGGC
TACGGGCTCCTCGCCCCGCAACACCAGCAAGCAACCACCATGTCCCGCGCCATCAAGGCCCCGAAAGGCTTGCCA
GAGCTGGTAGACCTCACATTTCGCAACTGTCGGACCAGCCAAGACGTCATCCACCACCCCTCGACAGTCGGCCTG
TTTCACGCGGGCCTCATTCCGTTCCAGATCCGCTTCTGTCCCGCCCTCGCGAAAATGCCCAAGCCGGTCAAGGAG
TCGTCTCGACCAGTTGACCCGTTCGCTAACCCGCCTGAGCGTTTGTGCTTGGGGGACGTTGGGCCGGGCCATTAC
CTCGTGCTGAACAAGTTTCCTATCTTGGATGGGCACTTTATCCTCGCGACGAAGCAGTTTGAGCCGCAAGGGTCG
CTGCTGGATGTTGCTGATTTTGAGGCTGCGTTGGCTTGTGTCAAGGCTTATGAGCATGTTGACGGGGGCCTATTT
GTCTTCTTTAATAGCGGTGAGCATTCGGGCGCTAGCCAGCCTCATCGCCACCTTCAGATGCTACCGATGAAGTCG
ATGCGTTTGGATCAAGACGGAGACGGAAAGGTGCCATCGTGGGAGCCTCTGATCACGCGGTCTTCCCTCCTCGAA
TCCGCGCCCTTCGTCACCTTCTCTCAAGATATCCAATCAGACGTATCGCCAGAAAAAGTCCGCACGACGTATTTA
AATCTCTACAGAAAGGCCTGCAACTCGCTGGGCATCGACGCAGAAGACCAGACGGAGGGCGAGGCCCGCATCAGC
TACAACCTCGGGCTGACGGCAGAGCGGCTGGTCGTGTGTCCGCGGCGGGCTGAAGGTGATGAGGAGGGCATGTTG
TCGCTTAACGGGACCGTTCTGGCTGGTACGGCGCTGGTGAAGAGCGAGGAGGTTTGGAGGGCTTTGACTGAGGGT
CCGGAGTTGCTGGAAGGGGTGTTGCGCAAGATTGGCGTGGAGAGGATAGGGAGTTGA
Transcript >Ophun1|6851
ATGGCACCGTCACCGCGCGCCGGCGGAGGCACAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCGTCTTTCCCTTGATGCTCATCTTCGGCGCCATCTTCTCGCTGCTCTCTCCCGAGACGCGC
TCAGCTCCCTACTACGCCGGCGAGCAGGCTCACGCGCAGACAGCCAACGAAGCGCCCAGCTACTTCGCCCGCAAA
GCCAACGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTGCCTTCTTCTTCTTCATCGTT
ACGAGGGGCGTCACCGATAAGCGCAGGTTGCAGGCGGGTCTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCGCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGGCCGC
AAGGACGACATGATTACCGCCGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGACATCTCGGGG
CATGTCTTCCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTGTTGCGAGCTGCTCGT
CTGAGGGCGGATGAGAGGTGTGTCGTCATGGCAGACGGGGCCGTCAAGGGCGCAGGCGTCGAGTCGGATGGGGAA
CAGACGTCGACGGAGCAGGGGCTTGGACCGGCAGCCAAGACGACCATTGTGGTTGTTGGCCTGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGATCGAAAAGTTTACCGGTCTGGTGACGGCGCTGGTGGGAGGC
TACGGGCTCCTCGCCCCGCAACACCAGCAAGCAACCACCATGTCCCGCGCCATCAAGGCCCCGAAAGGCTTGCCA
GAGCTGGTAGACCTCACATTTCGCAACTGTCGGACCAGCCAAGACGTCATCCACCACCCCTCGACAGTCGGCCTG
TTTCACGCGGGCCTCATTCCGTTCCAGATCCGCTTCTGTCCCGCCCTCGCGAAAATGCCCAAGCCGGTCAAGGAG
TCGTCTCGACCAGTTGACCCGTTCGCTAACCCGCCTGAGCGTTTGTGCTTGGGGGACGTTGGGCCGGGCCATTAC
CTCGTGCTGAACAAGTTTCCTATCTTGGATGGGCACTTTATCCTCGCGACGAAGCAGTTTGAGCCGCAAGGGTCG
CTGCTGGATGTTGCTGATTTTGAGGCTGCGTTGGCTTGTGTCAAGGCTTATGAGCATGTTGACGGGGGCCTATTT
GTCTTCTTTAATAGCGGTGAGCATTCGGGCGCTAGCCAGCCTCATCGCCACCTTCAGATGCTACCGATGAAGTCG
ATGCGTTTGGATCAAGACGGAGACGGAAAGGTGCCATCGTGGGAGCCTCTGATCACGCGGTCTTCCCTCCTCGAA
TCCGCGCCCTTCGTCACCTTCTCTCAAGATATCCAATCAGACGTATCGCCAGAAAAAGTCCGCACGACGTATTTA
AATCTCTACAGAAAGGCCTGCAACTCGCTGGGCATCGACGCAGAAGACCAGACGGAGGGCGAGGCCCGCATCAGC
TACAACCTCGGGCTGACGGCAGAGCGGCTGGTCGTGTGTCCGCGGCGGGCTGAAGGTGATGAGGAGGGCATGTTG
TCGCTTAACGGGACCGTTCTGGCTGGTACGGCGCTGGTGAAGAGCGAGGAGGTTTGGAGGGCTTTGACTGAGGGT
CCGGAGTTGCTGGAAGGGGTGTTGCGCAAGATTGGCGTGGAGAGGATAGGGAGTTGA
Gene >Ophun1|6851
ATGGCACCGTCACCGCGCGCCGGCGGAGGCACAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCGTCTTTCCCTTGATGCTCATCTTCGGCGCCATCTTCTCGCTGCTCTCTCCCGAGACGCGC
TCAGCTCCCTACTACGCCGGCGAGCAGGCTCACGCGCAGACAGCCAACGAAGCGCCCAGCTACTTCGCCCGCAAA
GCCAACGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTGCCTTCTTCTTCTTCATCGTT
ACGAGGGGCGTCACCGATAAGCGCAGGTTGCAGGCGGGTCTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCGCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGGCCGC
AAGGACGACATGATTACCGCCGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGACATCTCGGGG
CATGTCTTCCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTGTTGCGAGCTGCTCGT
CTGAGGGCGGATGAGAGGTGTGTCGTCATGGCAGACGGGGCCGTCAAGGGCGCAGGCGTCGAGTCGGATGGGGAA
CAGACGTCGACGGAGCAGGGGCTTGGACCGGCAGCCAAGACGACCATTGTGGTTGTTGGCCTGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGATCGAAAAGGTACGCTTCCTGCTTGTTGACGATGATCTGTCG
GGCTTTGGCTAACTCTTGGCAACAGTTTACCGGTCTGGTGACGGCGCTGGTGGGAGGCTACGGGCTGTATATTGT
GCCACGCTTCGTGCCTGGCTTGAGGGCTGTTGTCGGACTGCCGGGGATATAATGGGGGCAGACCAGCGTGGCTTA
CATAGAGTAAGATGAGGTCACGGCTCTAATGAGGCAGCTAGATGACGAGGACTGTATATGCGGTGGCTAGCTGTA
TATTTATGAGAGGCCTTGACTGCACGTGTGAACATTGAAGCCATGCTTCGTAGCTTGTGTCGTAGATGACTGTCT
GACTTGATGTTGATGCCGTTATCGATATCGGCGAGGCTGGGTCAACCTCGGAAAGCTACTGTCGTCATCACCCAA
CGACTCTCACAGGGACGAGTTGCTCAACTCCTCCTCTATCCGAAACAAAACGAGCTACAATCTCCGAGAAACGTC
AAGCCCCGAATGCTCGTCTGCTAAACCCCTGACAACCACCGAAGCCTCGCCCCGCAACACCAGCAAGCAACCACC
ATGTCCCGCGCCATCAAGGCCCCGAAAGGCTTGCCAGAGCTGGTAGACCTCACATTTCGCAACTGTCGGACCAGC
CAAGACGTCATCCACCACCCCTCGACAGTCGGCCTGTTTCACGCGGGCCTCATTCCGGTATGCCAACGGCCGGAG
CCCACCTCACGCCGTTTCCCAGACTGACAATCCCCGACCTCGCAGTTCCAGATCCGCTTCTGTCCCGCCCTCGCG
AAAATGCCCAAGCCGGTCAAGGAGTCGTCTCGACCAGTTGACCCGTTCGCTAACCCGCCTGAGCGTTTGTGCTTG
GGGGACGTTGGGCCGGGCCATTACCTCGTGCTGAACAAGTTTCCTATCTTGGATGGGCACTTTATCCTCGCGACG
AAGCAGTTTGAGCCGCAAGGGTCGCTGCTGGATGTTGCTGATTTTGAGGCTGCGTTGGCTTGTGTCAAGGCTTAT
GAGCATGTTGACGGGGGCCTATTTGTCTTCTTTAATAGCGGTGAGCATTCGGGCGCTAGCCAGCCTCATCGCCAC
CTTCAGATGCTACCGATGAAGTCGATGCGTTTGGATCAAGACGGAGACGGAAAGGTGCCATCGTGGGAGCCTCTG
ATCACGCGGTCTTCCCTCCTCGAATCCGCGCCCTTCGTCACCTTCTCTCAAGATATCCAATCAGACGTATCGCCA
GAAAAAGTCCGCACGACGTATTTAAATCTCTACAGAAAGGCCTGCAACTCGCTGGGCATCGACGCAGAAGACCAG
ACGGAGGGCGAGGCCCGCATCAGCTACAACCTCGGGCTGACGGCAGAGCGGCTGGTCGTGTGTCCGCGGCGGGCT
GAAGGTGATGAGGAGGGCATGTTGTCGCTTAACGGGACCGTTCTGGCTGGTACGGCGCTGGTGAAGAGCGAGGAG
GTTTGGAGGGCTTTGACTGAGGGTCCGGAGTTGCTGGAAGGGGTGTTGCGCAAGATTGGCGTGGAGAGGATAGGG
AGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail