Protein ID | Ophun1|6842 |
Gene name | |
Location | Contig_789:4179..5613 |
Strand | + |
Gene length (bp) | 1434 |
Transcript length (bp) | 1350 |
Coding sequence length (bp) | 1350 |
Protein length (aa) | 450 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00318 | Ribosomal_S2 | Ribosomal protein S2 | 2.2E-60 | 134 | 329 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P32902|RT04_YEAST | 37S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1 | 102 | 339 | 3.0E-60 |
sp|O13970|RT04_SCHPO | 37S ribosomal protein mrp4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp4 PE=3 SV=2 | 87 | 343 | 1.0E-55 |
sp|B2KC76|RS2_ELUMP | 30S ribosomal protein S2 OS=Elusimicrobium minutum (strain Pei191) GN=rpsB PE=3 SV=1 | 128 | 342 | 2.0E-31 |
sp|A9ISJ8|RS2_BART1 | 30S ribosomal protein S2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsB PE=3 SV=2 | 128 | 333 | 3.0E-31 |
sp|P80371|RS2_THET8 | 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 | 126 | 320 | 1.0E-30 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P32902|RT04_YEAST | 37S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1 | 102 | 339 | 3.0E-60 |
sp|O13970|RT04_SCHPO | 37S ribosomal protein mrp4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp4 PE=3 SV=2 | 87 | 343 | 1.0E-55 |
sp|B2KC76|RS2_ELUMP | 30S ribosomal protein S2 OS=Elusimicrobium minutum (strain Pei191) GN=rpsB PE=3 SV=1 | 128 | 342 | 2.0E-31 |
sp|A9ISJ8|RS2_BART1 | 30S ribosomal protein S2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsB PE=3 SV=2 | 128 | 333 | 3.0E-31 |
sp|P80371|RS2_THET8 | 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 | 126 | 320 | 1.0E-30 |
sp|P62662|RS2_THET2 | 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsB PE=1 SV=2 | 126 | 320 | 1.0E-30 |
sp|A1USD9|RS2_BARBK | 30S ribosomal protein S2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsB PE=3 SV=1 | 128 | 333 | 4.0E-30 |
sp|Q6G5C9|RS2_BARHE | 30S ribosomal protein S2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsB PE=3 SV=1 | 128 | 333 | 6.0E-30 |
sp|A8YVR9|RS2_LACH4 | 30S ribosomal protein S2 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsB PE=3 SV=1 | 129 | 339 | 7.0E-30 |
sp|Q8UFM3|RS2_AGRFC | 30S ribosomal protein S2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-29 |
sp|B5ZN83|RS2_RHILW | 30S ribosomal protein S2 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-29 |
sp|Q2K8Y7|RS2_RHIEC | 30S ribosomal protein S2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-29 |
sp|Q3ZZC1|RS2_DEHMC | 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsB PE=3 SV=1 | 134 | 325 | 1.0E-29 |
sp|A5FS79|RS2_DEHMB | 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsB PE=3 SV=1 | 134 | 325 | 1.0E-29 |
sp|B3PYP2|RS2_RHIE6 | 30S ribosomal protein S2 OS=Rhizobium etli (strain CIAT 652) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-29 |
sp|Q2NBU6|RS2_ERYLH | 30S ribosomal protein S2 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsB PE=3 SV=2 | 129 | 328 | 2.0E-29 |
sp|B6ISV1|RS2_RHOCS | 30S ribosomal protein S2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsB PE=3 SV=1 | 130 | 319 | 2.0E-29 |
sp|A9GIN6|RS2_SORC5 | 30S ribosomal protein S2 OS=Sorangium cellulosum (strain So ce56) GN=rpsB PE=3 SV=1 | 124 | 333 | 2.0E-29 |
sp|Q3Z9H6|RS2_DEHM1 | 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsB PE=3 SV=1 | 134 | 323 | 2.0E-29 |
sp|Q1D1H9|RS2_MYXXD | 30S ribosomal protein S2 OS=Myxococcus xanthus (strain DK 1622) GN=rpsB PE=3 SV=1 | 129 | 332 | 2.0E-29 |
sp|B9EBD6|RS2_MACCJ | 30S ribosomal protein S2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-29 |
sp|B9JEX0|RS2_AGRRK | 30S ribosomal protein S2 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsB PE=3 SV=1 | 128 | 341 | 2.0E-29 |
sp|Q1MH54|RS2_RHIL3 | 30S ribosomal protein S2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsB PE=3 SV=1 | 128 | 333 | 3.0E-29 |
sp|A7HMF2|RS2_FERNB | 30S ribosomal protein S2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsB PE=3 SV=1 | 129 | 338 | 3.0E-29 |
sp|Q6FZN0|RS2_BARQU | 30S ribosomal protein S2 OS=Bartonella quintana (strain Toulouse) GN=rpsB PE=3 SV=1 | 128 | 333 | 3.0E-29 |
sp|A6X0J1|RS2_OCHA4 | 30S ribosomal protein S2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsB PE=3 SV=1 | 128 | 333 | 4.0E-29 |
sp|Q6HEY8|RS2_BACHK | 30S ribosomal protein S2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|Q636J9|RS2_BACCZ | 30S ribosomal protein S2 OS=Bacillus cereus (strain ZK / E33L) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|B9IVB6|RS2_BACCQ | 30S ribosomal protein S2 OS=Bacillus cereus (strain Q1) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|B7HLG0|RS2_BACC7 | 30S ribosomal protein S2 OS=Bacillus cereus (strain AH187) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|C1EP51|RS2_BACC3 | 30S ribosomal protein S2 OS=Bacillus cereus (strain 03BB102) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|Q9XBK3|RS2_BACC1 | 30S ribosomal protein S2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsB PE=3 SV=2 | 129 | 325 | 4.0E-29 |
sp|B7JJA5|RS2_BACC0 | 30S ribosomal protein S2 OS=Bacillus cereus (strain AH820) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|Q81WK8|RS2_BACAN | 30S ribosomal protein S2 OS=Bacillus anthracis GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|A0RHK0|RS2_BACAH | 30S ribosomal protein S2 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|C3L7A0|RS2_BACAC | 30S ribosomal protein S2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|C3P5M9|RS2_BACAA | 30S ribosomal protein S2 OS=Bacillus anthracis (strain A0248) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-29 |
sp|Q819X9|RS2_BACCR | 30S ribosomal protein S2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-29 |
sp|B7HDV0|RS2_BACC4 | 30S ribosomal protein S2 OS=Bacillus cereus (strain B4264) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-29 |
sp|B7IUI6|RS2_BACC2 | 30S ribosomal protein S2 OS=Bacillus cereus (strain G9842) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-29 |
sp|O67809|RS2_AQUAE | 30S ribosomal protein S2 OS=Aquifex aeolicus (strain VF5) GN=rpsB PE=3 SV=1 | 129 | 368 | 5.0E-29 |
sp|A9VT65|RS2_BACWK | 30S ribosomal protein S2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-29 |
sp|Q0BSM5|RS2_GRABC | 30S ribosomal protein S2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsB PE=3 SV=1 | 128 | 325 | 6.0E-29 |
sp|A6U8K2|RS2_SINMW | 30S ribosomal protein S2 OS=Sinorhizobium medicae (strain WSM419) GN=rpsB PE=3 SV=1 | 128 | 341 | 7.0E-29 |
sp|B7IHT3|RS2_THEAB | 30S ribosomal protein S2 OS=Thermosipho africanus (strain TCF52B) GN=rpsB PE=3 SV=1 | 129 | 346 | 7.0E-29 |
sp|A5VQT3|RS2_BRUO2 | 30S ribosomal protein S2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsB PE=3 SV=1 | 128 | 333 | 8.0E-29 |
sp|Q2W4C3|RS2_MAGSA | 30S ribosomal protein S2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsB PE=3 SV=1 | 130 | 319 | 9.0E-29 |
sp|Q8G0D6|RS2_BRUSU | 30S ribosomal protein S2 OS=Brucella suis biovar 1 (strain 1330) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|B0CGV9|RS2_BRUSI | 30S ribosomal protein S2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|C0RJD0|RS2_BRUMB | 30S ribosomal protein S2 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|A9M5H4|RS2_BRUC2 | 30S ribosomal protein S2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|Q57CX7|RS2_BRUAB | 30S ribosomal protein S2 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|Q2YRJ1|RS2_BRUA2 | 30S ribosomal protein S2 OS=Brucella abortus (strain 2308) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|B2S611|RS2_BRUA1 | 30S ribosomal protein S2 OS=Brucella abortus (strain S19) GN=rpsB PE=3 SV=1 | 128 | 333 | 9.0E-29 |
sp|C3MBQ2|RS2_RHISN | 30S ribosomal protein S2 OS=Rhizobium sp. (strain NGR234) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-28 |
sp|Q313G2|RS2_DESAG | 30S ribosomal protein S2 OS=Desulfovibrio alaskensis (strain G20) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-28 |
sp|B2IGT0|RS2_BEII9 | 30S ribosomal protein S2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsB PE=3 SV=2 | 128 | 332 | 1.0E-28 |
sp|B8G458|RS2_CHLAD | 30S ribosomal protein S2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsB PE=3 SV=1 | 126 | 339 | 2.0E-28 |
sp|Q5FJM3|RS2_LACAC | 30S ribosomal protein S2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsB PE=3 SV=1 | 129 | 351 | 2.0E-28 |
sp|B9LEM0|RS2_CHLSY | 30S ribosomal protein S2 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsB PE=3 SV=1 | 126 | 333 | 2.0E-28 |
sp|A9WAF9|RS2_CHLAA | 30S ribosomal protein S2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsB PE=3 SV=1 | 126 | 333 | 2.0E-28 |
sp|Q11IJ8|RS2_CHESB | 30S ribosomal protein S2 OS=Chelativorans sp. (strain BNC1) GN=rpsB PE=3 SV=1 | 128 | 333 | 2.0E-28 |
sp|Q2RU09|RS2_RHORT | 30S ribosomal protein S2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsB PE=3 SV=1 | 130 | 334 | 3.0E-28 |
sp|Q5FUV7|RS2_GLUOX | 30S ribosomal protein S2 OS=Gluconobacter oxydans (strain 621H) GN=rpsB PE=3 SV=1 | 128 | 339 | 5.0E-28 |
sp|Q98MB2|RS2_RHILO | 30S ribosomal protein S2 OS=Rhizobium loti (strain MAFF303099) GN=rpsB PE=3 SV=1 | 128 | 333 | 6.0E-28 |
sp|A7GRF7|RS2_BACCN | 30S ribosomal protein S2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsB PE=3 SV=1 | 129 | 325 | 8.0E-28 |
sp|Q7MAK0|RS2_WOLSU | 30S ribosomal protein S2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsB PE=3 SV=1 | 129 | 370 | 9.0E-28 |
sp|B8FGE6|RS2_DESAA | 30S ribosomal protein S2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsB PE=3 SV=1 | 129 | 331 | 9.0E-28 |
sp|Q3SRH2|RS2_NITWN | 30S ribosomal protein S2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsB PE=3 SV=1 | 128 | 338 | 9.0E-28 |
sp|Q92Q55|RS2_RHIME | 30S ribosomal protein S2 OS=Rhizobium meliloti (strain 1021) GN=rpsB PE=3 SV=1 | 128 | 341 | 1.0E-27 |
sp|Q8RA21|RS2_CALS4 | 30S ribosomal protein S2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-27 |
sp|Q8YHH6|RS2_BRUME | 30S ribosomal protein S2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsB PE=3 SV=2 | 128 | 333 | 1.0E-27 |
sp|Q89KP3|RS2_BRADU | 30S ribosomal protein S2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsB PE=3 SV=1 | 128 | 332 | 1.0E-27 |
sp|Q185S8|RS2_PEPD6 | 30S ribosomal protein S2 OS=Peptoclostridium difficile (strain 630) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-27 |
sp|Q8CSU2|RS2_STAES | 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsB PE=3 SV=1 | 129 | 349 | 1.0E-27 |
sp|Q5HPT5|RS2_STAEQ | 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsB PE=3 SV=1 | 129 | 349 | 1.0E-27 |
sp|A8I460|RS2_AZOC5 | 30S ribosomal protein S2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsB PE=3 SV=1 | 128 | 332 | 1.0E-27 |
sp|A6LLI6|RS2_THEM4 | 30S ribosomal protein S2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-27 |
sp|Q1QMN7|RS2_NITHX | 30S ribosomal protein S2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsB PE=3 SV=1 | 128 | 332 | 2.0E-27 |
sp|C6C1T1|RS2_DESAD | 30S ribosomal protein S2 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsB PE=3 SV=1 | 129 | 338 | 2.0E-27 |
sp|A9B458|RS2_HERA2 | 30S ribosomal protein S2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-27 |
sp|C4XMY2|RS2_DESMR | 30S ribosomal protein S2 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-27 |
sp|Q74IR7|RS2_LACJO | 30S ribosomal protein S2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-27 |
sp|Q044D0|RS2_LACGA | 30S ribosomal protein S2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsB PE=3 SV=2 | 129 | 325 | 2.0E-27 |
sp|Q4L5V8|RS2_STAHJ | 30S ribosomal protein S2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsB PE=3 SV=1 | 129 | 349 | 3.0E-27 |
sp|Q2GCI4|RS2_NEOSM | 30S ribosomal protein S2 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpsB PE=3 SV=1 | 129 | 335 | 3.0E-27 |
sp|Q49X41|RS2_STAS1 | 30S ribosomal protein S2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsB PE=3 SV=1 | 129 | 345 | 4.0E-27 |
sp|Q215E9|RS2_RHOPB | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsB PE=3 SV=1 | 128 | 332 | 5.0E-27 |
sp|Q7VH95|RS2_HELHP | 30S ribosomal protein S2 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsB PE=3 SV=1 | 129 | 358 | 5.0E-27 |
sp|A7H716|RS2_ANADF | 30S ribosomal protein S2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsB PE=3 SV=1 | 129 | 332 | 5.0E-27 |
sp|B0JTL2|RS2_MICAN | 30S ribosomal protein S2 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-27 |
sp|Q8DS11|RS2_STRMU | 30S ribosomal protein S2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsB PE=3 SV=1 | 129 | 360 | 7.0E-27 |
sp|Q03QS1|RS2_LACBA | 30S ribosomal protein S2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsB PE=3 SV=1 | 129 | 341 | 8.0E-27 |
sp|B9DPG8|RS2_STACT | 30S ribosomal protein S2 OS=Staphylococcus carnosus (strain TM300) GN=rpsB PE=3 SV=1 | 129 | 330 | 9.0E-27 |
sp|B1HQZ0|RS2_LYSSC | 30S ribosomal protein S2 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsB PE=3 SV=2 | 129 | 325 | 9.0E-27 |
sp|Q8RIH7|RS2_FUSNN | 30S ribosomal protein S2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsB PE=3 SV=1 | 129 | 331 | 1.0E-26 |
sp|A5EK55|RS2_BRASB | 30S ribosomal protein S2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsB PE=3 SV=1 | 128 | 332 | 1.0E-26 |
sp|Q92JF5|RS2_RICCN | 30S ribosomal protein S2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsB PE=3 SV=1 | 129 | 337 | 1.0E-26 |
sp|A4YVG6|RS2_BRASO | 30S ribosomal protein S2 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsB PE=3 SV=1 | 128 | 332 | 1.0E-26 |
sp|Q07NJ3|RS2_RHOP5 | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsB PE=3 SV=1 | 128 | 364 | 1.0E-26 |
sp|P66545|RS2_STAAW | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MW2) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|A8Z3T6|RS2_STAAT | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|Q6G9V7|RS2_STAAS | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MSSA476) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|Q6GHH9|RS2_STAAR | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MRSA252) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|P66544|RS2_STAAN | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain N315) GN=rpsB PE=1 SV=1 | 129 | 345 | 1.0E-26 |
sp|P66543|RS2_STAAM | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|A6QGF6|RS2_STAAE | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Newman) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|Q2YXL2|RS2_STAAB | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|Q2FZ25|RS2_STAA8 | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsB PE=3 SV=2 | 129 | 345 | 1.0E-26 |
sp|Q2FHI2|RS2_STAA3 | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|A7X1N3|RS2_STAA1 | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsB PE=3 SV=1 | 129 | 345 | 1.0E-26 |
sp|A8MHG9|RS2_ALKOO | 30S ribosomal protein S2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-26 |
sp|A5ISE0|RS2_STAA9 | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH9) GN=rpsB PE=3 SV=1 | 129 | 345 | 2.0E-26 |
sp|A6U174|RS2_STAA2 | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH1) GN=rpsB PE=3 SV=1 | 129 | 345 | 2.0E-26 |
sp|A6LHM7|RS2_PARD8 | 30S ribosomal protein S2 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsB PE=3 SV=1 | 129 | 347 | 2.0E-26 |
sp|Q6F0Q4|RS2_MESFL | 30S ribosomal protein S2 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsB PE=3 SV=2 | 127 | 334 | 2.0E-26 |
sp|Q9X5E7|RS2_ZYMMO | 30S ribosomal protein S2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-26 |
sp|A5V3G2|RS2_SPHWW | 30S ribosomal protein S2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-26 |
sp|Q9ZJ70|RS2_HELPJ | 30S ribosomal protein S2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsB PE=3 SV=1 | 129 | 336 | 2.0E-26 |
sp|Q1CR52|RS2_HELPH | 30S ribosomal protein S2 OS=Helicobacter pylori (strain HPAG1) GN=rpsB PE=3 SV=1 | 129 | 336 | 2.0E-26 |
sp|B6JP48|RS2_HELP2 | 30S ribosomal protein S2 OS=Helicobacter pylori (strain P12) GN=rpsB PE=3 SV=1 | 129 | 336 | 2.0E-26 |
sp|B8IQY6|RS2_METNO | 30S ribosomal protein S2 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsB PE=3 SV=1 | 128 | 332 | 3.0E-26 |
sp|P56009|RS2_HELPY | 30S ribosomal protein S2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsB PE=3 SV=1 | 129 | 370 | 3.0E-26 |
sp|B2UVV5|RS2_HELPS | 30S ribosomal protein S2 OS=Helicobacter pylori (strain Shi470) GN=rpsB PE=3 SV=1 | 129 | 336 | 3.0E-26 |
sp|C3PMC2|RS2_RICAE | 30S ribosomal protein S2 OS=Rickettsia africae (strain ESF-5) GN=rpsB PE=3 SV=1 | 129 | 337 | 3.0E-26 |
sp|Q5HGH6|RS2_STAAC | 30S ribosomal protein S2 OS=Staphylococcus aureus (strain COL) GN=rpsB PE=3 SV=1 | 129 | 345 | 3.0E-26 |
sp|B3E716|RS2_GEOLS | 30S ribosomal protein S2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsB PE=3 SV=1 | 129 | 340 | 3.0E-26 |
sp|P74071|RS2_SYNY3 | 30S ribosomal protein S2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsB PE=3 SV=1 | 129 | 340 | 3.0E-26 |
sp|Q9TM33|RR2_CYACA | 30S ribosomal protein S2, chloroplastic OS=Cyanidium caldarium GN=rps2 PE=3 SV=1 | 128 | 325 | 3.0E-26 |
sp|B0K1P9|RS2_THEPX | 30S ribosomal protein S2 OS=Thermoanaerobacter sp. (strain X514) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-26 |
sp|B2G6U1|RS2_LACRJ | 30S ribosomal protein S2 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsB PE=3 SV=1 | 129 | 349 | 4.0E-26 |
sp|A5VJC5|RS2_LACRD | 30S ribosomal protein S2 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsB PE=3 SV=1 | 129 | 349 | 4.0E-26 |
sp|Q73K75|RS2_TREDE | 30S ribosomal protein S2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|Q8Y6M6|RS2_LISMO | 30S ribosomal protein S2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|B8DFR3|RS2_LISMH | 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|Q71Z11|RS2_LISMF | 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|C1KVV4|RS2_LISMC | 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|A0AJB1|RS2_LISW6 | 30S ribosomal protein S2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|Q92B01|RS2_LISIN | 30S ribosomal protein S2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|A5CE04|RS2_ORITB | 30S ribosomal protein S2 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsB PE=3 SV=2 | 121 | 379 | 4.0E-26 |
sp|B1YI76|RS2_EXIS2 | 30S ribosomal protein S2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-26 |
sp|B0K9R6|RS2_THEP3 | 30S ribosomal protein S2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-26 |
sp|Q17YZ7|RS2_HELAH | 30S ribosomal protein S2 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsB PE=3 SV=1 | 129 | 336 | 5.0E-26 |
sp|B8E2Y2|RS2_DICTD | 30S ribosomal protein S2 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsB PE=3 SV=1 | 129 | 337 | 5.0E-26 |
sp|Q2SSA8|RS2_MYCCT | 30S ribosomal protein S2 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsB PE=3 SV=1 | 128 | 338 | 5.0E-26 |
sp|B8CW53|RS2_HALOH | 30S ribosomal protein S2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsB PE=3 SV=1 | 129 | 330 | 5.0E-26 |
sp|A8GQP7|RS2_RICRS | 30S ribosomal protein S2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsB PE=3 SV=1 | 129 | 337 | 5.0E-26 |
sp|B0BW38|RS2_RICRO | 30S ribosomal protein S2 OS=Rickettsia rickettsii (strain Iowa) GN=rpsB PE=3 SV=1 | 129 | 337 | 5.0E-26 |
sp|Q5HTT2|RS2_CAMJR | 30S ribosomal protein S2 OS=Campylobacter jejuni (strain RM1221) GN=rpsB PE=3 SV=1 | 129 | 384 | 6.0E-26 |
sp|A1W0G6|RS2_CAMJJ | 30S ribosomal protein S2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsB PE=3 SV=1 | 129 | 384 | 6.0E-26 |
sp|A8FMN8|RS2_CAMJ8 | 30S ribosomal protein S2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsB PE=3 SV=1 | 129 | 384 | 6.0E-26 |
sp|B4UMB8|RS2_ANASK | 30S ribosomal protein S2 OS=Anaeromyxobacter sp. (strain K) GN=rpsB PE=3 SV=1 | 129 | 332 | 6.0E-26 |
sp|Q2IML9|RS2_ANADE | 30S ribosomal protein S2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsB PE=3 SV=2 | 129 | 332 | 6.0E-26 |
sp|C4K1A0|RS2_RICPU | 30S ribosomal protein S2 OS=Rickettsia peacockii (strain Rustic) GN=rpsB PE=3 SV=1 | 129 | 337 | 6.0E-26 |
sp|Q9PNB3|RS2_CAMJE | 30S ribosomal protein S2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsB PE=3 SV=1 | 129 | 384 | 7.0E-26 |
sp|B5YEG9|RS2_DICT6 | 30S ribosomal protein S2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsB PE=3 SV=1 | 129 | 337 | 7.0E-26 |
sp|Q116Q2|RS2_TRIEI | 30S ribosomal protein S2 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsB PE=3 SV=1 | 129 | 335 | 7.0E-26 |
sp|A0LJ63|RS2_SYNFM | 30S ribosomal protein S2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsB PE=3 SV=1 | 129 | 339 | 7.0E-26 |
sp|Q5HB22|RS2_EHRRW | 30S ribosomal protein S2 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsB PE=3 SV=1 | 130 | 319 | 8.0E-26 |
sp|Q5FGZ8|RS2_EHRRG | 30S ribosomal protein S2 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsB PE=3 SV=1 | 130 | 319 | 8.0E-26 |
sp|A5UUV2|RS2_ROSS1 | 30S ribosomal protein S2 OS=Roseiflexus sp. (strain RS-1) GN=rpsB PE=3 SV=1 | 129 | 333 | 9.0E-26 |
sp|A8F0I9|RS2_RICM5 | 30S ribosomal protein S2 OS=Rickettsia massiliae (strain Mtu5) GN=rpsB PE=3 SV=2 | 129 | 337 | 1.0E-25 |
sp|Q1IU82|RS2_KORVE | 30S ribosomal protein S2 OS=Koribacter versatilis (strain Ellin345) GN=rpsB PE=3 SV=1 | 128 | 331 | 1.0E-25 |
sp|B1H053|RS2_UNCTG | 30S ribosomal protein S2 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsB PE=3 SV=1 | 128 | 325 | 1.0E-25 |
sp|Q3YRV2|RS2_EHRCJ | 30S ribosomal protein S2 OS=Ehrlichia canis (strain Jake) GN=rpsB PE=3 SV=1 | 130 | 319 | 1.0E-25 |
sp|A1AQN2|RS2_PELPD | 30S ribosomal protein S2 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsB PE=3 SV=1 | 129 | 366 | 1.0E-25 |
sp|Q1GRQ0|RS2_SPHAL | 30S ribosomal protein S2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsB PE=3 SV=1 | 129 | 332 | 1.0E-25 |
sp|A1VFA8|RS2_DESVV | 30S ribosomal protein S2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-25 |
sp|Q72DQ5|RS2_DESVH | 30S ribosomal protein S2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-25 |
sp|Q2GGV4|RS2_EHRCR | 30S ribosomal protein S2 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsB PE=3 SV=1 | 130 | 319 | 2.0E-25 |
sp|Q03FT6|RS2_PEDPA | 30S ribosomal protein S2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsB PE=3 SV=1 | 129 | 360 | 2.0E-25 |
sp|B5Y8I9|RS2_COPPD | 30S ribosomal protein S2 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-25 |
sp|B6JH66|RS2_OLICO | 30S ribosomal protein S2 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsB PE=3 SV=1 | 128 | 332 | 2.0E-25 |
sp|Q1WUL5|RS2_LACS1 | 30S ribosomal protein S2 OS=Lactobacillus salivarius (strain UCC118) GN=rpsB PE=3 SV=1 | 129 | 327 | 2.0E-25 |
sp|Q65JJ9|RS2_BACLD | 30S ribosomal protein S2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-25 |
sp|A7H2J2|RS2_CAMJD | 30S ribosomal protein S2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsB PE=3 SV=1 | 129 | 384 | 2.0E-25 |
sp|A7ZF28|RS2_CAMC1 | 30S ribosomal protein S2 OS=Campylobacter concisus (strain 13826) GN=rpsB PE=3 SV=1 | 129 | 384 | 2.0E-25 |
sp|A7INR6|RS2_XANP2 | 30S ribosomal protein S2 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsB PE=3 SV=1 | 128 | 332 | 2.0E-25 |
sp|Q5L763|RS2_CHLAB | 30S ribosomal protein S2 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsB PE=3 SV=1 | 128 | 334 | 2.0E-25 |
sp|Q252Q7|RS2_CHLFF | 30S ribosomal protein S2 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsB PE=3 SV=1 | 128 | 334 | 3.0E-25 |
sp|Q2IW80|RS2_RHOP2 | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsB PE=3 SV=1 | 128 | 338 | 3.0E-25 |
sp|A3CQW3|RS2_STRSV | 30S ribosomal protein S2 OS=Streptococcus sanguinis (strain SK36) GN=rpsB PE=3 SV=1 | 129 | 360 | 3.0E-25 |
sp|P71145|RS2_CHLMU | 30S ribosomal protein S2 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsB PE=3 SV=2 | 128 | 332 | 3.0E-25 |
sp|A4IMC3|RS2_GEOTN | 30S ribosomal protein S2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-25 |
sp|B9MKQ1|RS2_CALBD | 30S ribosomal protein S2 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsB PE=3 SV=1 | 129 | 330 | 3.0E-25 |
sp|C5D9B5|RS2_GEOSW | 30S ribosomal protein S2 OS=Geobacillus sp. (strain WCH70) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-25 |
sp|A5FZ67|RS2_ACICJ | 30S ribosomal protein S2 OS=Acidiphilium cryptum (strain JF-5) GN=rpsB PE=3 SV=1 | 128 | 325 | 3.0E-25 |
sp|Q9Z7K9|RS2_CHLPN | 30S ribosomal protein S2 OS=Chlamydia pneumoniae GN=rpsB PE=3 SV=1 | 129 | 322 | 3.0E-25 |
sp|B0UCS0|RS2_METS4 | 30S ribosomal protein S2 OS=Methylobacterium sp. (strain 4-46) GN=rpsB PE=3 SV=1 | 128 | 332 | 3.0E-25 |
sp|Q831U9|RS2_ENTFA | 30S ribosomal protein S2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsB PE=3 SV=1 | 129 | 336 | 3.0E-25 |
sp|A7I1L3|RS2_CAMHC | 30S ribosomal protein S2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-25 |
sp|A8AZP1|RS2_STRGC | 30S ribosomal protein S2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsB PE=3 SV=1 | 129 | 362 | 4.0E-25 |
sp|Q02AL1|RS2_SOLUE | 30S ribosomal protein S2 OS=Solibacter usitatus (strain Ellin6076) GN=rpsB PE=3 SV=1 | 129 | 349 | 4.0E-25 |
sp|P49668|RS2_PEDAC | 30S ribosomal protein S2 OS=Pediococcus acidilactici GN=rpsB PE=3 SV=1 | 129 | 340 | 4.0E-25 |
sp|Q5L0K2|RS2_GEOKA | 30S ribosomal protein S2 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsB PE=3 SV=1 | 129 | 325 | 4.0E-25 |
sp|A4X4J2|RS2_SALTO | 30S ribosomal protein S2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpsB PE=3 SV=1 | 129 | 347 | 4.0E-25 |
sp|A0L8Q5|RS2_MAGMM | 30S ribosomal protein S2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsB PE=3 SV=1 | 134 | 323 | 4.0E-25 |
sp|B5YGD9|RS2_THEYD | 30S ribosomal protein S2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-25 |
sp|Q1MRE3|RS2_LAWIP | 30S ribosomal protein S2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsB PE=3 SV=1 | 129 | 336 | 4.0E-25 |
sp|P21464|RS2_BACSU | 30S ribosomal protein S2 OS=Bacillus subtilis (strain 168) GN=rpsB PE=1 SV=3 | 129 | 325 | 5.0E-25 |
sp|A6Q585|RS2_NITSB | 30S ribosomal protein S2 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-25 |
sp|Q049U2|RS2_LACDB | 30S ribosomal protein S2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsB PE=3 SV=1 | 129 | 339 | 5.0E-25 |
sp|Q1G9N6|RS2_LACDA | 30S ribosomal protein S2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsB PE=3 SV=1 | 129 | 339 | 5.0E-25 |
sp|Q2G8L0|RS2_NOVAD | 30S ribosomal protein S2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsB PE=3 SV=1 | 129 | 331 | 5.0E-25 |
sp|Q4UND8|RS2_RICFE | 30S ribosomal protein S2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsB PE=3 SV=1 | 129 | 337 | 5.0E-25 |
sp|A7GWR7|RS2_CAMC5 | 30S ribosomal protein S2 OS=Campylobacter curvus (strain 525.92) GN=rpsB PE=3 SV=2 | 129 | 383 | 5.0E-25 |
sp|Q8FP70|RS2_COREF | 30S ribosomal protein S2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpsB PE=3 SV=1 | 129 | 335 | 6.0E-25 |
sp|B0S184|RS2_FINM2 | 30S ribosomal protein S2 OS=Finegoldia magna (strain ATCC 29328) GN=rpsB PE=3 SV=1 | 129 | 325 | 6.0E-25 |
sp|B8J3M5|RS2_DESDA | 30S ribosomal protein S2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-25 |
sp|B2S3J6|RS2_TREPS | 30S ribosomal protein S2 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsB PE=3 SV=1 | 129 | 325 | 6.0E-25 |
sp|O83615|RS2_TREPA | 30S ribosomal protein S2 OS=Treponema pallidum (strain Nichols) GN=rpsB PE=3 SV=1 | 129 | 325 | 6.0E-25 |
sp|C0QB17|RS2_DESAH | 30S ribosomal protein S2 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsB PE=3 SV=1 | 129 | 340 | 7.0E-25 |
sp|B8DSA6|RS2_DESVM | 30S ribosomal protein S2 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsB PE=3 SV=1 | 129 | 339 | 7.0E-25 |
sp|C0MEG6|RS2_STRS7 | 30S ribosomal protein S2 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsB PE=3 SV=1 | 129 | 360 | 9.0E-25 |
sp|C0MAG7|RS2_STRE4 | 30S ribosomal protein S2 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsB PE=3 SV=1 | 129 | 360 | 9.0E-25 |
sp|Q24UF7|RS2_DESHY | 30S ribosomal protein S2 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsB PE=3 SV=1 | 129 | 330 | 9.0E-25 |
sp|B8FRG5|RS2_DESHD | 30S ribosomal protein S2 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsB PE=3 SV=1 | 129 | 330 | 9.0E-25 |
sp|A9HRQ9|RS2_GLUDA | 30S ribosomal protein S2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsB PE=3 SV=3 | 128 | 319 | 9.0E-25 |
sp|A4XM02|RS2_CALS8 | 30S ribosomal protein S2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsB PE=3 SV=1 | 129 | 325 | 9.0E-25 |
sp|Q5GRH8|RS2_WOLTR | 30S ribosomal protein S2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsB PE=3 SV=1 | 120 | 319 | 1.0E-24 |
sp|Q9KA63|RS2_BACHD | 30S ribosomal protein S2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-24 |
sp|Q2GKU9|RS2_ANAPZ | 30S ribosomal protein S2 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsB PE=3 SV=1 | 128 | 322 | 1.0E-24 |
sp|A8M6B1|RS2_SALAI | 30S ribosomal protein S2 OS=Salinispora arenicola (strain CNS-205) GN=rpsB PE=3 SV=1 | 129 | 347 | 1.0E-24 |
sp|B1MZ65|RS2_LEUCK | 30S ribosomal protein S2 OS=Leuconostoc citreum (strain KM20) GN=rpsB PE=3 SV=2 | 129 | 325 | 1.0E-24 |
sp|Q30PK5|RS2_SULDN | 30S ribosomal protein S2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsB PE=3 SV=1 | 129 | 383 | 1.0E-24 |
sp|C0ZF66|RS2_BREBN | 30S ribosomal protein S2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsB PE=3 SV=1 | 129 | 338 | 1.0E-24 |
sp|Q68XV5|RS2_RICTY | 30S ribosomal protein S2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsB PE=3 SV=1 | 129 | 337 | 2.0E-24 |
sp|B1WQZ8|RS2_CYAA5 | 30S ribosomal protein S2 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-24 |
sp|Q0S285|RS2_RHOJR | 30S ribosomal protein S2 OS=Rhodococcus jostii (strain RHA1) GN=rpsB PE=3 SV=1 | 129 | 349 | 2.0E-24 |
sp|B9DW41|RS2_STRU0 | 30S ribosomal protein S2 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsB PE=3 SV=1 | 129 | 362 | 2.0E-24 |
sp|B1XQQ1|RS2_SYNP2 | 30S ribosomal protein S2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-24 |
sp|A3DE59|RS2_CLOTH | 30S ribosomal protein S2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsB PE=3 SV=1 | 129 | 342 | 2.0E-24 |
sp|A8GM32|RS2_RICAH | 30S ribosomal protein S2 OS=Rickettsia akari (strain Hartford) GN=rpsB PE=3 SV=1 | 129 | 337 | 2.0E-24 |
sp|Q8F140|RS2_LEPIN | 30S ribosomal protein S2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsB PE=3 SV=1 | 129 | 330 | 2.0E-24 |
sp|Q72U14|RS2_LEPIC | 30S ribosomal protein S2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsB PE=3 SV=1 | 129 | 330 | 2.0E-24 |
sp|A7Z4S0|RS2_BACMF | 30S ribosomal protein S2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-24 |
sp|Q136A4|RS2_RHOPS | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsB PE=3 SV=1 | 128 | 332 | 2.0E-24 |
sp|C4LJA9|RS2_CORK4 | 30S ribosomal protein S2 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-24 |
sp|Q5LRZ4|RS2_RUEPO | 30S ribosomal protein S2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsB PE=3 SV=1 | 128 | 334 | 3.0E-24 |
sp|C1B2U2|RS2_RHOOB | 30S ribosomal protein S2 OS=Rhodococcus opacus (strain B4) GN=rpsB PE=3 SV=1 | 129 | 333 | 3.0E-24 |
sp|Q3AB77|RS2_CARHZ | 30S ribosomal protein S2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsB PE=3 SV=1 | 129 | 328 | 4.0E-24 |
sp|Q5F5F3|RS2_NEIG1 | 30S ribosomal protein S2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsB PE=3 SV=1 | 129 | 337 | 4.0E-24 |
sp|P35014|RR2_GALSU | 30S ribosomal protein S2, chloroplastic OS=Galdieria sulphuraria GN=rps2 PE=3 SV=1 | 129 | 322 | 4.0E-24 |
sp|A8F717|RS2_PSELT | 30S ribosomal protein S2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-24 |
sp|Q165Z3|RS2_ROSDO | 30S ribosomal protein S2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsB PE=3 SV=1 | 128 | 334 | 5.0E-24 |
sp|B8EKA1|RS2_METSB | 30S ribosomal protein S2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsB PE=3 SV=1 | 128 | 332 | 5.0E-24 |
sp|A8LK91|RS2_DINSH | 30S ribosomal protein S2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsB PE=3 SV=1 | 128 | 334 | 5.0E-24 |
sp|A5GTG8|RS2_SYNR3 | 30S ribosomal protein S2 OS=Synechococcus sp. (strain RCC307) GN=rpsB PE=3 SV=1 | 129 | 340 | 5.0E-24 |
sp|Q04U72|RS2_LEPBJ | 30S ribosomal protein S2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsB PE=3 SV=2 | 129 | 330 | 6.0E-24 |
sp|A9BGV6|RS2_PETMO | 30S ribosomal protein S2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsB PE=3 SV=1 | 129 | 335 | 7.0E-24 |
sp|Q03WX5|RS2_LEUMM | 30S ribosomal protein S2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsB PE=3 SV=1 | 129 | 325 | 7.0E-24 |
sp|P48132|RR2_CYAPA | Cyanelle 30S ribosomal protein S2 OS=Cyanophora paradoxa GN=rps2 PE=3 SV=1 | 129 | 330 | 7.0E-24 |
sp|A4J5Z3|RS2_DESRM | 30S ribosomal protein S2 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsB PE=3 SV=1 | 129 | 325 | 7.0E-24 |
sp|Q9ZE61|RS2_RICPR | 30S ribosomal protein S2 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsB PE=3 SV=1 | 129 | 337 | 7.0E-24 |
sp|Q0AYK4|RS2_SYNWW | 30S ribosomal protein S2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsB PE=3 SV=2 | 129 | 330 | 7.0E-24 |
sp|A0RQU8|RS2_CAMFF | 30S ribosomal protein S2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsB PE=3 SV=1 | 129 | 339 | 8.0E-24 |
sp|B3Q7K4|RS2_RHOPT | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsB PE=3 SV=1 | 128 | 345 | 8.0E-24 |
sp|Q6N5Q2|RS2_RHOPA | 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsB PE=1 SV=1 | 128 | 345 | 8.0E-24 |
sp|Q3KL14|RS2_CHLTA | 30S ribosomal protein S2 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsB PE=3 SV=1 | 125 | 332 | 9.0E-24 |
sp|Q28PY9|RS2_JANSC | 30S ribosomal protein S2 OS=Jannaschia sp. (strain CCS1) GN=rpsB PE=3 SV=1 | 128 | 338 | 9.0E-24 |
sp|Q6MGY6|RS2_BDEBA | 30S ribosomal protein S2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsB PE=3 SV=1 | 129 | 331 | 1.0E-23 |
sp|A9NHC6|RS2_ACHLI | 30S ribosomal protein S2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-23 |
sp|A1B8E9|RS2_PARDP | 30S ribosomal protein S2 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsB PE=3 SV=1 | 128 | 329 | 1.0E-23 |
sp|Q47S53|RS2_THEFY | 30S ribosomal protein S2 OS=Thermobifida fusca (strain YX) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-23 |
sp|Q8EQV3|RS2_OCEIH | 30S ribosomal protein S2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-23 |
sp|O33038|RS2_MYCLE | 30S ribosomal protein S2 OS=Mycobacterium leprae (strain TN) GN=rpsB PE=3 SV=1 | 129 | 333 | 1.0E-23 |
sp|Q6MEY9|RS2_PARUW | 30S ribosomal protein S2 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-23 |
sp|P66540|RS2_NEIMB | 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsB PE=1 SV=1 | 129 | 337 | 1.0E-23 |
sp|P66539|RS2_NEIMA | 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsB PE=3 SV=1 | 129 | 337 | 1.0E-23 |
sp|C1CVN8|RS2_DEIDV | 30S ribosomal protein S2 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsB PE=3 SV=2 | 129 | 323 | 1.0E-23 |
sp|C0ZY15|RS2_RHOE4 | 30S ribosomal protein S2 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsB PE=3 SV=1 | 129 | 349 | 1.0E-23 |
sp|Q5PAF6|RS2_ANAMM | 30S ribosomal protein S2 OS=Anaplasma marginale (strain St. Maries) GN=rpsB PE=3 SV=2 | 134 | 324 | 1.0E-23 |
sp|Q9X5U8|RS2_COXBU | 30S ribosomal protein S2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsB PE=3 SV=1 | 128 | 323 | 1.0E-23 |
sp|A9N8R0|RS2_COXBR | 30S ribosomal protein S2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsB PE=3 SV=1 | 128 | 323 | 1.0E-23 |
sp|A9KBR3|RS2_COXBN | 30S ribosomal protein S2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsB PE=3 SV=1 | 128 | 323 | 1.0E-23 |
sp|A6TRM3|RS2_ALKMQ | 30S ribosomal protein S2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-23 |
sp|A9M489|RS2_NEIM0 | 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsB PE=3 SV=1 | 129 | 338 | 1.0E-23 |
sp|Q1IZI6|RS2_DEIGD | 30S ribosomal protein S2 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsB PE=3 SV=1 | 129 | 323 | 1.0E-23 |
sp|A1KWH6|RS2_NEIMF | 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsB PE=3 SV=1 | 129 | 337 | 1.0E-23 |
sp|B7K4S8|RS2_CYAP8 | 30S ribosomal protein S2 OS=Cyanothece sp. (strain PCC 8801) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-23 |
sp|Q3ZIZ5|RR2_PSEAK | 30S ribosomal protein S2, chloroplastic OS=Pseudendoclonium akinetum GN=rps2 PE=3 SV=1 | 123 | 336 | 1.0E-23 |
sp|Q9RU79|RS2_DEIRA | 30S ribosomal protein S2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsB PE=3 SV=1 | 129 | 323 | 1.0E-23 |
sp|B2J6U9|RS2_NOSP7 | 30S ribosomal protein S2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-23 |
sp|B3WES8|RS2_LACCB | 30S ribosomal protein S2 OS=Lactobacillus casei (strain BL23) GN=rpsB PE=3 SV=1 | 129 | 367 | 2.0E-23 |
sp|Q038L2|RS2_LACC3 | 30S ribosomal protein S2 OS=Lactobacillus casei (strain ATCC 334) GN=rpsB PE=3 SV=1 | 129 | 367 | 2.0E-23 |
sp|Q824U3|RS2_CHLCV | 30S ribosomal protein S2 OS=Chlamydophila caviae (strain GPIC) GN=rpsB PE=3 SV=1 | 134 | 334 | 2.0E-23 |
sp|B2GBL8|RS2_LACF3 | 30S ribosomal protein S2 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsB PE=3 SV=1 | 129 | 325 | 2.0E-23 |
sp|Q98Q36|RS2_MYCPU | 30S ribosomal protein S2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsB PE=3 SV=1 | 134 | 325 | 2.0E-23 |
sp|Q6YR51|RS2_ONYPE | 30S ribosomal protein S2 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsB PE=3 SV=1 | 129 | 330 | 2.0E-23 |
sp|B8I6D2|RS2_CLOCE | 30S ribosomal protein S2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsB PE=3 SV=1 | 129 | 328 | 2.0E-23 |
sp|A8EXF0|RS2_RICCK | 30S ribosomal protein S2 OS=Rickettsia canadensis (strain McKiel) GN=rpsB PE=3 SV=1 | 129 | 337 | 2.0E-23 |
sp|Q2RJP3|RS2_MOOTA | 30S ribosomal protein S2 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsB PE=3 SV=1 | 129 | 338 | 3.0E-23 |
sp|Q9MUS8|RR2_MESVI | 30S ribosomal protein S2, chloroplastic OS=Mesostigma viride GN=rps2 PE=3 SV=1 | 129 | 331 | 3.0E-23 |
sp|A6Q715|RS2_SULNB | 30S ribosomal protein S2 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-23 |
sp|Q3MBF3|RS2_ANAVT | 30S ribosomal protein S2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsB PE=3 SV=1 | 129 | 335 | 3.0E-23 |
sp|A9W4G3|RS2_METEP | 30S ribosomal protein S2 OS=Methylobacterium extorquens (strain PA1) GN=rpsB PE=3 SV=1 | 128 | 332 | 3.0E-23 |
sp|B7KZG0|RS2_METC4 | 30S ribosomal protein S2 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsB PE=3 SV=1 | 128 | 332 | 3.0E-23 |
sp|B9M5C6|RS2_GEODF | 30S ribosomal protein S2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsB PE=3 SV=1 | 128 | 340 | 3.0E-23 |
sp|Q88VJ4|RS2_LACPL | 30S ribosomal protein S2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsB PE=3 SV=1 | 129 | 351 | 3.0E-23 |
sp|B1LTQ8|RS2_METRJ | 30S ribosomal protein S2 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsB PE=3 SV=1 | 128 | 332 | 3.0E-23 |
sp|P56351|RR2_CHLVU | 30S ribosomal protein S2, chloroplastic OS=Chlorella vulgaris GN=rps2 PE=3 SV=1 | 127 | 341 | 3.0E-23 |
sp|Q2JLB3|RS2_SYNJB | 30S ribosomal protein S2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsB PE=3 SV=1 | 129 | 340 | 3.0E-23 |
sp|Q8YMY2|RS2_NOSS1 | 30S ribosomal protein S2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsB PE=3 SV=1 | 129 | 335 | 3.0E-23 |
sp|B3EU84|RS2_AMOA5 | 30S ribosomal protein S2 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsB PE=3 SV=1 | 129 | 338 | 3.0E-23 |
sp|B7GG89|RS2_ANOFW | 30S ribosomal protein S2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-23 |
sp|C5BWU1|RS2_BEUC1 | 30S ribosomal protein S2 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rpsB PE=3 SV=1 | 129 | 341 | 3.0E-23 |
sp|Q3A395|RS2_PELCD | 30S ribosomal protein S2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsB PE=3 SV=1 | 129 | 333 | 4.0E-23 |
sp|Q4G3A3|RR2_EMIHU | 30S ribosomal protein S2, chloroplastic OS=Emiliania huxleyi GN=rps2 PE=3 SV=1 | 129 | 323 | 4.0E-23 |
sp|A4WSP0|RS2_RHOS5 | 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsB PE=3 SV=2 | 128 | 349 | 4.0E-23 |
sp|Q1R033|RS2_CHRSD | 30S ribosomal protein S2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-23 |
sp|B8HFN5|RS2_ARTCA | 30S ribosomal protein S2 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rpsB PE=3 SV=1 | 129 | 360 | 4.0E-23 |
sp|O84687|RS2_CHLTR | 30S ribosomal protein S2 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsB PE=3 SV=1 | 129 | 332 | 4.0E-23 |
sp|A0LV54|RS2_ACIC1 | 30S ribosomal protein S2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsB PE=3 SV=1 | 129 | 330 | 5.0E-23 |
sp|B9KSF0|RS2_RHOSK | 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsB PE=3 SV=1 | 128 | 349 | 5.0E-23 |
sp|Q3J2N4|RS2_RHOS4 | 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsB PE=3 SV=1 | 128 | 349 | 5.0E-23 |
sp|C1F401|RS2_ACIC5 | 30S ribosomal protein S2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rpsB PE=3 SV=1 | 128 | 322 | 5.0E-23 |
sp|Q5YS61|RS2_NOCFA | 30S ribosomal protein S2 OS=Nocardia farcinica (strain IFM 10152) GN=rpsB PE=3 SV=1 | 129 | 349 | 5.0E-23 |
sp|B5Y1K2|RS2_KLEP3 | 30S ribosomal protein S2 OS=Klebsiella pneumoniae (strain 342) GN=rpsB PE=3 SV=1 | 129 | 339 | 5.0E-23 |
sp|A3PJM7|RS2_RHOS1 | 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsB PE=3 SV=1 | 128 | 349 | 5.0E-23 |
sp|Q0C1C1|RS2_HYPNA | 30S ribosomal protein S2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsB PE=3 SV=1 | 128 | 325 | 5.0E-23 |
sp|C4L650|RS2_EXISA | 30S ribosomal protein S2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-23 |
sp|Q7MX41|RS2_PORGI | 30S ribosomal protein S2 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-23 |
sp|B2RL62|RS2_PORG3 | 30S ribosomal protein S2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-23 |
sp|Q97I66|RS2_CLOAB | 30S ribosomal protein S2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsB PE=3 SV=1 | 129 | 328 | 6.0E-23 |
sp|Q31G43|RS2_THICR | 30S ribosomal protein S2 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsB PE=3 SV=2 | 129 | 340 | 7.0E-23 |
sp|Q1RH01|RS2_RICBR | 30S ribosomal protein S2 OS=Rickettsia bellii (strain RML369-C) GN=rpsB PE=3 SV=1 | 129 | 337 | 7.0E-23 |
sp|A8GUK1|RS2_RICB8 | 30S ribosomal protein S2 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsB PE=3 SV=1 | 129 | 337 | 7.0E-23 |
sp|Q6A7J7|RS2_PROAC | 30S ribosomal protein S2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpsB PE=3 SV=1 | 129 | 333 | 7.0E-23 |
sp|A0PQ79|RS2_MYCUA | 30S ribosomal protein S2 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsB PE=3 SV=2 | 129 | 345 | 8.0E-23 |
sp|A4W6R4|RS2_ENT38 | 30S ribosomal protein S2 OS=Enterobacter sp. (strain 638) GN=rpsB PE=3 SV=1 | 129 | 339 | 8.0E-23 |
sp|Q2LTQ7|RS2_SYNAS | 30S ribosomal protein S2 OS=Syntrophus aciditrophicus (strain SB) GN=rpsB PE=3 SV=1 | 129 | 353 | 8.0E-23 |
sp|C0R2L5|RS2_WOLWR | 30S ribosomal protein S2 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rpsB PE=3 SV=1 | 129 | 319 | 8.0E-23 |
sp|A7NQW2|RS2_ROSCS | 30S ribosomal protein S2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpsB PE=3 SV=1 | 129 | 344 | 9.0E-23 |
sp|Q1XDN8|RR2_PYRYE | 30S ribosomal protein S2, chloroplastic OS=Pyropia yezoensis GN=rps2 PE=3 SV=1 | 129 | 325 | 9.0E-23 |
sp|B0THD7|RS2_HELMI | 30S ribosomal protein S2 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsB PE=3 SV=1 | 129 | 331 | 9.0E-23 |
sp|B1ZQ51|RS2_OPITP | 30S ribosomal protein S2 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsB PE=3 SV=1 | 128 | 329 | 9.0E-23 |
sp|A8Z5V2|RS2_SULMW | 30S ribosomal protein S2 OS=Sulcia muelleri (strain GWSS) GN=rpsB PE=3 SV=1 | 131 | 325 | 9.0E-23 |
sp|Q485H0|RS2_COLP3 | 30S ribosomal protein S2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsB PE=3 SV=1 | 128 | 339 | 1.0E-22 |
sp|P51249|RR2_PORPU | 30S ribosomal protein S2, chloroplastic OS=Porphyra purpurea GN=rps2 PE=3 SV=1 | 129 | 341 | 1.0E-22 |
sp|B2GKT6|RS2_KOCRD | 30S ribosomal protein S2 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpsB PE=3 SV=1 | 129 | 333 | 1.0E-22 |
sp|B1I2K0|RS2_DESAP | 30S ribosomal protein S2 OS=Desulforudis audaxviator (strain MP104C) GN=rpsB PE=3 SV=1 | 129 | 328 | 1.0E-22 |
sp|Q2S6J0|RS2_SALRD | 30S ribosomal protein S2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsB PE=3 SV=2 | 129 | 333 | 1.0E-22 |
sp|Q2NIS2|RS2_AYWBP | 30S ribosomal protein S2 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsB PE=3 SV=1 | 129 | 330 | 1.0E-22 |
sp|A0JUP1|RS2_ARTS2 | 30S ribosomal protein S2 OS=Arthrobacter sp. (strain FB24) GN=rpsB PE=3 SV=1 | 129 | 360 | 1.0E-22 |
sp|A6T4X1|RS2_KLEP7 | 30S ribosomal protein S2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsB PE=3 SV=2 | 129 | 339 | 1.0E-22 |
sp|Q38W64|RS2_LACSS | 30S ribosomal protein S2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsB PE=3 SV=1 | 129 | 327 | 1.0E-22 |
sp|B1JQG0|RS2_YERPY | 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|Q667I9|RS2_YERPS | 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|A4TL92|RS2_YERPP | 30S ribosomal protein S2 OS=Yersinia pestis (strain Pestoides F) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|Q1CFE6|RS2_YERPN | 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|A9R396|RS2_YERPG | 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|Q8ZH66|RS2_YERPE | 30S ribosomal protein S2 OS=Yersinia pestis GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|B2JZ34|RS2_YERPB | 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|Q1CAN6|RS2_YERPA | 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|A7FFG9|RS2_YERP3 | 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsB PE=3 SV=1 | 129 | 339 | 1.0E-22 |
sp|Q73VQ7|RS2_MYCPA | 30S ribosomal protein S2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsB PE=3 SV=1 | 129 | 333 | 1.0E-22 |
sp|Q7N8P7|RS2_PHOLL | 30S ribosomal protein S2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|Q4JV18|RS2_CORJK | 30S ribosomal protein S2 OS=Corynebacterium jeikeium (strain K411) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-22 |
sp|A5CQS5|RS2_CLAM3 | 30S ribosomal protein S2 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpsB PE=3 SV=1 | 129 | 360 | 2.0E-22 |
sp|P41605|RR2_PINTH | 30S ribosomal protein S2, chloroplastic OS=Pinus thunbergii GN=rps2 PE=3 SV=1 | 128 | 325 | 2.0E-22 |
sp|Q83SL4|RS2_SHIFL | 30S ribosomal protein S2 OS=Shigella flexneri GN=rpsB PE=3 SV=4 | 129 | 339 | 2.0E-22 |
sp|Q0T840|RS2_SHIF8 | 30S ribosomal protein S2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsB PE=3 SV=2 | 129 | 339 | 2.0E-22 |
sp|A4QF32|RS2_CORGB | 30S ribosomal protein S2 OS=Corynebacterium glutamicum (strain R) GN=rpsB PE=3 SV=1 | 129 | 335 | 2.0E-22 |
sp|C5BQF6|RS2_TERTT | 30S ribosomal protein S2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-22 |
sp|Q2JU28|RS2_SYNJA | 30S ribosomal protein S2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsB PE=3 SV=1 | 129 | 345 | 2.0E-22 |
sp|Q0RDQ4|RS2_FRAAA | 30S ribosomal protein S2 OS=Frankia alni (strain ACN14a) GN=rpsB PE=3 SV=2 | 129 | 326 | 2.0E-22 |
sp|B0C075|RS2_ACAM1 | 30S ribosomal protein S2 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsB PE=3 SV=1 | 129 | 350 | 2.0E-22 |
sp|Q8NP01|RS2_CORGL | 30S ribosomal protein S2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsB PE=3 SV=1 | 129 | 335 | 2.0E-22 |
sp|A7HY19|RS2_PARL1 | 30S ribosomal protein S2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsB PE=3 SV=1 | 128 | 340 | 2.0E-22 |
sp|C6E512|RS2_GEOSM | 30S ribosomal protein S2 OS=Geobacter sp. (strain M21) GN=rpsB PE=3 SV=1 | 128 | 333 | 2.0E-22 |
sp|A5GLE0|RS2_SYNPW | 30S ribosomal protein S2 OS=Synechococcus sp. (strain WH7803) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-22 |
sp|Q11QN6|RS2_CYTH3 | 30S ribosomal protein S2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpsB PE=3 SV=1 | 134 | 345 | 2.0E-22 |
sp|P19679|RS2_SPICI | 30S ribosomal protein S2 OS=Spiroplasma citri GN=rpsB PE=3 SV=2 | 127 | 319 | 2.0E-22 |
sp|Q85X64|RR2_PINKO | 30S ribosomal protein S2, chloroplastic OS=Pinus koraiensis GN=rps2 PE=3 SV=3 | 128 | 325 | 2.0E-22 |
sp|A0QVB8|RS2_MYCS2 | 30S ribosomal protein S2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsB PE=3 SV=2 | 129 | 333 | 2.0E-22 |
sp|B1VG89|RS2_CORU7 | 30S ribosomal protein S2 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpsB PE=3 SV=1 | 129 | 329 | 2.0E-22 |
sp|P66541|RS2_SALTY | 30S ribosomal protein S2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsB PE=3 SV=2 | 129 | 339 | 2.0E-22 |
sp|P66542|RS2_SALTI | 30S ribosomal protein S2 OS=Salmonella typhi GN=rpsB PE=3 SV=2 | 129 | 339 | 2.0E-22 |
sp|B4TXS1|RS2_SALSV | 30S ribosomal protein S2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B5BAM6|RS2_SALPK | 30S ribosomal protein S2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|A9N0R7|RS2_SALPB | 30S ribosomal protein S2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsB PE=3 SV=2 | 129 | 339 | 2.0E-22 |
sp|Q5PD63|RS2_SALPA | 30S ribosomal protein S2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsB PE=3 SV=3 | 129 | 339 | 2.0E-22 |
sp|B4SUZ8|RS2_SALNS | 30S ribosomal protein S2 OS=Salmonella newport (strain SL254) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B4TK44|RS2_SALHS | 30S ribosomal protein S2 OS=Salmonella heidelberg (strain SL476) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B5RHF4|RS2_SALG2 | 30S ribosomal protein S2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B5R3I2|RS2_SALEP | 30S ribosomal protein S2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B5FJ16|RS2_SALDC | 30S ribosomal protein S2 OS=Salmonella dublin (strain CT_02021853) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|A9MPJ3|RS2_SALAR | 30S ribosomal protein S2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|B5F8T0|RS2_SALA4 | 30S ribosomal protein S2 OS=Salmonella agona (strain SL483) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-22 |
sp|Q6FA53|RS2_ACIAD | 30S ribosomal protein S2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsB PE=3 SV=1 | 128 | 325 | 2.0E-22 |
sp|Q73HM1|RS2_WOLPM | 30S ribosomal protein S2 OS=Wolbachia pipientis wMel GN=rpsB PE=3 SV=1 | 129 | 319 | 3.0E-22 |
sp|B1VA80|RS2_PHYAS | 30S ribosomal protein S2 OS=Phytoplasma australiense GN=rpsB PE=3 SV=1 | 129 | 330 | 3.0E-22 |
sp|A8ALC1|RS2_CITK8 | 30S ribosomal protein S2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|Q6NGK5|RS2_CORDI | 30S ribosomal protein S2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpsB PE=3 SV=1 | 129 | 331 | 3.0E-22 |
sp|A9KNC4|RS2_CLOPH | 30S ribosomal protein S2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-22 |
sp|C6DAI3|RS2_PECCP | 30S ribosomal protein S2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B1X437|RR2_PAUCH | 30S ribosomal protein S2, organellar chromatophore OS=Paulinella chromatophora GN=rps2 PE=3 SV=1 | 129 | 329 | 3.0E-22 |
sp|B4RBZ4|RS2_PHEZH | 30S ribosomal protein S2 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsB PE=3 SV=1 | 128 | 325 | 3.0E-22 |
sp|Q5WFS8|RS2_BACSK | 30S ribosomal protein S2 OS=Bacillus clausii (strain KSM-K16) GN=rpsB PE=3 SV=1 | 129 | 325 | 3.0E-22 |
sp|Q57T39|RS2_SALCH | 30S ribosomal protein S2 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|A2RNV0|RS2_LACLM | 30S ribosomal protein S2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsB PE=3 SV=1 | 129 | 342 | 3.0E-22 |
sp|B1VYT7|RS2_STRGG | 30S ribosomal protein S2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsB PE=3 SV=1 | 129 | 348 | 3.0E-22 |
sp|Q3AKA5|RS2_SYNSC | 30S ribosomal protein S2 OS=Synechococcus sp. (strain CC9605) GN=rpsB PE=3 SV=2 | 129 | 329 | 3.0E-22 |
sp|Q32JU0|RS2_SHIDS | 30S ribosomal protein S2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B7LWA8|RS2_ESCF3 | 30S ribosomal protein S2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|Q1RG21|RS2_ECOUT | 30S ribosomal protein S2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsB PE=3 SV=2 | 129 | 339 | 3.0E-22 |
sp|B1LGX0|RS2_ECOSM | 30S ribosomal protein S2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B7N836|RS2_ECOLU | 30S ribosomal protein S2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|P0A7V0|RS2_ECOLI | 30S ribosomal protein S2 OS=Escherichia coli (strain K12) GN=rpsB PE=1 SV=2 | 129 | 339 | 3.0E-22 |
sp|B1IQH2|RS2_ECOLC | 30S ribosomal protein S2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|P0A7V1|RS2_ECOL6 | 30S ribosomal protein S2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsB PE=3 SV=2 | 129 | 339 | 3.0E-22 |
sp|Q0TLG4|RS2_ECOL5 | 30S ribosomal protein S2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|A1A7L3|RS2_ECOK1 | 30S ribosomal protein S2 OS=Escherichia coli O1:K1 / APEC GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B1XD38|RS2_ECODH | 30S ribosomal protein S2 OS=Escherichia coli (strain K12 / DH10B) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|C4ZRR1|RS2_ECOBW | 30S ribosomal protein S2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B7MP29|RS2_ECO81 | 30S ribosomal protein S2 OS=Escherichia coli O81 (strain ED1a) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B7NID0|RS2_ECO7I | 30S ribosomal protein S2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B5Z0E7|RS2_ECO5E | 30S ribosomal protein S2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|P0A7V2|RS2_ECO57 | 30S ribosomal protein S2 OS=Escherichia coli O157:H7 GN=rpsB PE=3 SV=2 | 129 | 339 | 3.0E-22 |
sp|B7MBF0|RS2_ECO45 | 30S ribosomal protein S2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|B7UIL4|RS2_ECO27 | 30S ribosomal protein S2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 3.0E-22 |
sp|Q8CWM8|RS2_STRR6 | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsB PE=3 SV=1 | 129 | 327 | 3.0E-22 |
sp|Q04HW3|RS2_STRP2 | 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsB PE=3 SV=1 | 129 | 327 | 3.0E-22 |
sp|A5WCX2|RS2_PSYWF | 30S ribosomal protein S2 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsB PE=3 SV=2 | 126 | 325 | 3.0E-22 |
sp|P9WH39|RS2_MYCTU | 30S ribosomal protein S2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsB PE=1 SV=1 | 129 | 333 | 3.0E-22 |
sp|P9WH38|RS2_MYCTO | 30S ribosomal protein S2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsB PE=3 SV=1 | 129 | 333 | 3.0E-22 |
sp|P66538|RS2_MYCBO | 30S ribosomal protein S2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsB PE=3 SV=1 | 129 | 333 | 3.0E-22 |
sp|A1SLR0|RS2_NOCSJ | 30S ribosomal protein S2 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsB PE=3 SV=1 | 129 | 368 | 3.0E-22 |
sp|B0REP4|RS2_CLAMS | 30S ribosomal protein S2 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpsB PE=3 SV=1 | 129 | 360 | 3.0E-22 |
sp|B5EHW1|RS2_GEOBB | 30S ribosomal protein S2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsB PE=3 SV=1 | 128 | 333 | 4.0E-22 |
sp|Q46LH9|RS2_PROMT | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsB PE=3 SV=2 | 129 | 329 | 4.0E-22 |
sp|A2C1I7|RS2_PROM1 | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsB PE=3 SV=2 | 129 | 329 | 4.0E-22 |
sp|B2A380|RS2_NATTJ | 30S ribosomal protein S2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsB PE=3 SV=1 | 129 | 318 | 4.0E-22 |
sp|C1CUD2|RS2_STRZT | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|C1CNI8|RS2_STRZP | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain P1031) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|C1CHL4|RS2_STRZJ | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain JJA) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|B8ZQA6|RS2_STRPJ | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|C1CBJ2|RS2_STRP7 | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain 70585) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|B5E3W1|RS2_STRP4 | 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsB PE=3 SV=1 | 129 | 327 | 4.0E-22 |
sp|A7MGT2|RS2_CROS8 | 30S ribosomal protein S2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-22 |
sp|B2INN2|RS2_STRPS | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsB PE=3 SV=2 | 129 | 327 | 4.0E-22 |
sp|B0TP83|RS2_SHEHH | 30S ribosomal protein S2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-22 |
sp|Q2NRK7|RS2_SODGM | 30S ribosomal protein S2 OS=Sodalis glossinidius (strain morsitans) GN=rpsB PE=3 SV=1 | 129 | 339 | 4.0E-22 |
sp|A4W453|RS2_STRS2 | 30S ribosomal protein S2 OS=Streptococcus suis (strain 98HAH33) GN=rpsB PE=3 SV=2 | 129 | 331 | 5.0E-22 |
sp|A1JP82|RS2_YERE8 | 30S ribosomal protein S2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsB PE=3 SV=1 | 129 | 339 | 5.0E-22 |
sp|Q97N56|RS2_STRPN | 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsB PE=3 SV=1 | 129 | 327 | 5.0E-22 |
sp|B9KCX7|RS2_CAMLR | 30S ribosomal protein S2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsB PE=3 SV=1 | 129 | 333 | 5.0E-22 |
sp|Q1BAI2|RS2_MYCSS | 30S ribosomal protein S2 OS=Mycobacterium sp. (strain MCS) GN=rpsB PE=3 SV=1 | 129 | 333 | 5.0E-22 |
sp|A1UEI0|RS2_MYCSK | 30S ribosomal protein S2 OS=Mycobacterium sp. (strain KMS) GN=rpsB PE=3 SV=1 | 129 | 333 | 5.0E-22 |
sp|A3PXY4|RS2_MYCSJ | 30S ribosomal protein S2 OS=Mycobacterium sp. (strain JLS) GN=rpsB PE=3 SV=1 | 129 | 333 | 5.0E-22 |
sp|Q9WZM1|RS2_THEMA | 30S ribosomal protein S2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsB PE=3 SV=1 | 129 | 325 | 5.0E-22 |
sp|Q2L162|RS2_BORA1 | 30S ribosomal protein S2 OS=Bordetella avium (strain 197N) GN=rpsB PE=3 SV=1 | 134 | 334 | 5.0E-22 |
sp|A2CA98|RS2_PROM3 | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsB PE=3 SV=1 | 129 | 330 | 5.0E-22 |
sp|Q7VCB6|RS2_PROMA | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-22 |
sp|Q3JZ54|RS2_STRA1 | 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsB PE=3 SV=1 | 129 | 360 | 6.0E-22 |
sp|A5D2T5|RS2_PELTS | 30S ribosomal protein S2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsB PE=3 SV=1 | 129 | 325 | 6.0E-22 |
sp|Q7V7Z4|RS2_PROMM | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsB PE=3 SV=1 | 129 | 330 | 6.0E-22 |
sp|Q02VX8|RS2_LACLS | 30S ribosomal protein S2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsB PE=3 SV=1 | 129 | 342 | 6.0E-22 |
sp|A9BAS9|RS2_PROM4 | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsB PE=3 SV=1 | 129 | 329 | 6.0E-22 |
sp|Q7UKH4|RS2_RHOBA | 30S ribosomal protein S2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsB PE=3 SV=2 | 134 | 325 | 6.0E-22 |
sp|A4VXV7|RS2_STRSY | 30S ribosomal protein S2 OS=Streptococcus suis (strain 05ZYH33) GN=rpsB PE=3 SV=2 | 129 | 331 | 7.0E-22 |
sp|Q8DXL8|RS2_STRA5 | 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsB PE=3 SV=1 | 129 | 360 | 7.0E-22 |
sp|Q8E388|RS2_STRA3 | 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsB PE=3 SV=1 | 129 | 360 | 7.0E-22 |
sp|B4F2D3|RS2_PROMH | 30S ribosomal protein S2 OS=Proteus mirabilis (strain HI4320) GN=rpsB PE=3 SV=1 | 129 | 339 | 7.0E-22 |
sp|Q9CDR4|RS2_LACLA | 30S ribosomal protein S2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsB PE=3 SV=1 | 129 | 327 | 8.0E-22 |
sp|Q1GHC3|RS2_RUEST | 30S ribosomal protein S2 OS=Ruegeria sp. (strain TM1040) GN=rpsB PE=3 SV=1 | 128 | 334 | 8.0E-22 |
sp|P82923|RT02_BOVIN | 28S ribosomal protein S2, mitochondrial OS=Bos taurus GN=MRPS2 PE=1 SV=2 | 113 | 338 | 8.0E-22 |
sp|B1MDF2|RS2_MYCA9 | 30S ribosomal protein S2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsB PE=3 SV=1 | 129 | 333 | 9.0E-22 |
sp|B1IAC8|RS2_STRPI | 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsB PE=3 SV=1 | 129 | 325 | 9.0E-22 |
sp|A8ES83|RS2_ARCB4 | 30S ribosomal protein S2 OS=Arcobacter butzleri (strain RM4018) GN=rpsB PE=3 SV=1 | 129 | 329 | 9.0E-22 |
sp|Q3AXI9|RS2_SYNS9 | 30S ribosomal protein S2 OS=Synechococcus sp. (strain CC9902) GN=rpsB PE=3 SV=1 | 129 | 329 | 9.0E-22 |
sp|Q19VA1|RR2_CHLAT | 30S ribosomal protein S2, chloroplastic OS=Chlorokybus atmophyticus GN=rps2 PE=3 SV=2 | 129 | 329 | 9.0E-22 |
sp|Q0APW5|RS2_MARMM | 30S ribosomal protein S2 OS=Maricaulis maris (strain MCS10) GN=rpsB PE=3 SV=1 | 128 | 325 | 1.0E-21 |
sp|Q74BW1|RS2_GEOSL | 30S ribosomal protein S2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsB PE=3 SV=1 | 128 | 333 | 1.0E-21 |
sp|Q7U795|RS2_SYNPX | 30S ribosomal protein S2 OS=Synechococcus sp. (strain WH8102) GN=rpsB PE=3 SV=1 | 129 | 329 | 1.0E-21 |
sp|Q3BVK3|RS2_XANC5 | 30S ribosomal protein S2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-21 |
sp|Q85FR5|RR2_CYAME | 30S ribosomal protein S2, chloroplastic OS=Cyanidioschyzon merolae GN=rps2 PE=3 SV=1 | 131 | 329 | 1.0E-21 |
sp|A1U3Q4|RS2_MARHV | 30S ribosomal protein S2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsB PE=3 SV=1 | 129 | 322 | 1.0E-21 |
sp|A4TC67|RS2_MYCGI | 30S ribosomal protein S2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsB PE=3 SV=1 | 129 | 333 | 1.0E-21 |
sp|Q8PMK5|RS2_XANAC | 30S ribosomal protein S2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsB PE=3 SV=1 | 129 | 325 | 1.0E-21 |
sp|Q85FN0|RR2_ADICA | 30S ribosomal protein S2, chloroplastic OS=Adiantum capillus-veneris GN=rps2 PE=2 SV=2 | 129 | 329 | 1.0E-21 |
sp|O78482|RR2_GUITH | 30S ribosomal protein S2, chloroplastic OS=Guillardia theta GN=rps2 PE=3 SV=1 | 129 | 322 | 2.0E-21 |
sp|Q3Z5I9|RS2_SHISS | 30S ribosomal protein S2 OS=Shigella sonnei (strain Ss046) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|Q325X1|RS2_SHIBS | 30S ribosomal protein S2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|B2U311|RS2_SHIB3 | 30S ribosomal protein S2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|B6HZE3|RS2_ECOSE | 30S ribosomal protein S2 OS=Escherichia coli (strain SE11) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|A7ZWB5|RS2_ECOHS | 30S ribosomal protein S2 OS=Escherichia coli O9:H4 (strain HS) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|B7M1A9|RS2_ECO8A | 30S ribosomal protein S2 OS=Escherichia coli O8 (strain IAI1) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|B7LGN0|RS2_ECO55 | 30S ribosomal protein S2 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|A7ZHQ9|RS2_ECO24 | 30S ribosomal protein S2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|Q1QDT1|RS2_PSYCK | 30S ribosomal protein S2 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsB PE=3 SV=1 | 126 | 347 | 2.0E-21 |
sp|Q4FUT9|RS2_PSYA2 | 30S ribosomal protein S2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsB PE=3 SV=1 | 126 | 347 | 2.0E-21 |
sp|Q924T2|RT02_MOUSE | 28S ribosomal protein S2, mitochondrial OS=Mus musculus GN=Mrps2 PE=1 SV=1 | 113 | 338 | 2.0E-21 |
sp|A5G7W8|RS2_GEOUR | 30S ribosomal protein S2 OS=Geobacter uraniireducens (strain Rf4) GN=rpsB PE=3 SV=1 | 128 | 366 | 2.0E-21 |
sp|A8H6L6|RS2_SHEPA | 30S ribosomal protein S2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsB PE=3 SV=1 | 129 | 339 | 2.0E-21 |
sp|Q39W88|RS2_GEOMG | 30S ribosomal protein S2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsB PE=3 SV=1 | 129 | 333 | 2.0E-21 |
sp|A2BQN9|RS2_PROMS | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain AS9601) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-21 |
sp|A8G4D1|RS2_PROM2 | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-21 |
sp|A3PCG1|RS2_PROM0 | 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsB PE=3 SV=1 | 129 | 331 | 2.0E-21 |
sp|Q9A703|RS2_CAUCR | 30S ribosomal protein S2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsB PE=3 SV=1 | 128 | 325 | 2.0E-21 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003735 | structural constituent of ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0005840 | ribosome | Yes |
GO:0043043 | peptide biosynthetic process | No |
GO:0043226 | organelle | No |
GO:0043229 | intracellular organelle | No |
GO:0043170 | macromolecule metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0019538 | protein metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0005198 | structural molecule activity | No |
GO:0044238 | primary metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0110165 | cellular anatomical entity | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0005575 | cellular_component | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0043603 | cellular amide metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 18 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|6842 MAPALVKSALRRASTEAGPSKKPNASEIKEMGMKMRSASGSPRIPNAAKKKRQAEAQNGFTSLLAGELRKHKGES WTRSHQVGDMMVTPAQQYAFFQKIRSRSRGIGSEVSKLYTPAQHINNPPWPEDVTLELLMASQTHMGHHTSLWNP INSQYIYGIREGIHIISLEATMAHLRRAARVMEGVLYRGGIVLFVGNRPGQMEIVVRAAELAGGYFLFTAWKPGG ITNRDAILKSHGMKVVDHLDKKIPGFDNYLNVARPVLPALVVCLNPLENAVLLHECSLKHVPTIGIIDTDADPSW VTYPIPCNDDSLRAMSVICGALGRAGERGTKRRLEESAEGKVTWDTPPEIIRHMRKEVVEAEAKQAQVMQMMEMD HEDFNEEEKKILRSGKPQAEGRAEVKEEEMLDMLSQASVGRAAVAAAIAAAAVDEVPTEDKDAGERTPPPPSGS* |
Coding | >Ophun1|6842 ATGGCTCCGGCTCTGGTCAAGAGTGCCCTCCGACGGGCGTCTACCGAAGCCGGGCCGAGCAAGAAGCCCAACGCA AGCGAAATCAAGGAGATGGGCATGAAGATGCGAAGCGCTTCTGGATCGCCGAGGATTCCCAACGCGGCCAAGAAG AAGAGACAAGCCGAGGCGCAGAATGGCTTTACCAGCTTGTTAGCGGGCGAACTGCGAAAGCACAAAGGCGAATCG TGGACGAGGTCGCATCAGGTGGGAGACATGATGGTGACGCCGGCGCAGCAGTACGCATTCTTTCAGAAGATTCGG TCGCGGTCGCGTGGCATCGGGTCTGAGGTGTCCAAGCTTTACACCCCCGCGCAGCACATCAACAACCCTCCCTGG CCCGAAGACGTGACGCTGGAGCTGCTGATGGCGTCGCAGACGCACATGGGACACCATACTTCGCTGTGGAATCCG ATCAACTCGCAGTACATCTATGGCATACGCGAGGGCATTCACATCATCTCTCTGGAGGCGACGATGGCGCATCTG CGGCGGGCGGCGAGGGTGATGGAGGGCGTGCTGTACCGCGGCGGCATCGTTCTCTTTGTCGGAAATCGGCCTGGG CAAATGGAGATTGTCGTCAGGGCGGCCGAATTGGCGGGCGGGTATTTTCTCTTCACTGCCTGGAAGCCGGGCGGC ATCACGAACCGCGATGCCATTCTCAAGTCGCACGGGATGAAGGTGGTGGACCATCTCGACAAGAAAATTCCTGGG TTCGATAACTACCTCAACGTGGCACGGCCTGTGCTACCTGCCCTGGTTGTCTGTCTGAATCCGCTCGAGAATGCC GTCCTGCTGCACGAGTGCAGCCTCAAGCACGTCCCGACGATTGGCATCATCGATACCGACGCCGACCCATCGTGG GTGACGTACCCTATTCCATGCAACGATGACAGCCTCCGAGCCATGTCTGTCATCTGCGGCGCCCTCGGCAGGGCG GGCGAAAGGGGCACAAAGCGAAGGCTCGAAGAATCAGCCGAAGGAAAAGTAACGTGGGACACACCGCCCGAAATC ATCCGCCACATGAGAAAAGAGGTTGTAGAGGCCGAAGCCAAGCAAGCGCAGGTCATGCAAATGATGGAAATGGAC CACGAGGACTTTAACGAAGAAGAGAAGAAGATTCTTCGGAGCGGAAAGCCCCAGGCTGAAGGGCGCGCAGAGGTC AAGGAGGAGGAGATGCTCGATATGTTGAGCCAGGCGTCTGTCGGACGCGCGGCTGTGGCTGCGGCTATAGCTGCG GCGGCGGTTGACGAGGTTCCGACTGAGGACAAGGACGCAGGAGAGAGGACGCCGCCGCCGCCGTCGGGATCATAG |
Transcript | >Ophun1|6842 ATGGCTCCGGCTCTGGTCAAGAGTGCCCTCCGACGGGCGTCTACCGAAGCCGGGCCGAGCAAGAAGCCCAACGCA AGCGAAATCAAGGAGATGGGCATGAAGATGCGAAGCGCTTCTGGATCGCCGAGGATTCCCAACGCGGCCAAGAAG AAGAGACAAGCCGAGGCGCAGAATGGCTTTACCAGCTTGTTAGCGGGCGAACTGCGAAAGCACAAAGGCGAATCG TGGACGAGGTCGCATCAGGTGGGAGACATGATGGTGACGCCGGCGCAGCAGTACGCATTCTTTCAGAAGATTCGG TCGCGGTCGCGTGGCATCGGGTCTGAGGTGTCCAAGCTTTACACCCCCGCGCAGCACATCAACAACCCTCCCTGG CCCGAAGACGTGACGCTGGAGCTGCTGATGGCGTCGCAGACGCACATGGGACACCATACTTCGCTGTGGAATCCG ATCAACTCGCAGTACATCTATGGCATACGCGAGGGCATTCACATCATCTCTCTGGAGGCGACGATGGCGCATCTG CGGCGGGCGGCGAGGGTGATGGAGGGCGTGCTGTACCGCGGCGGCATCGTTCTCTTTGTCGGAAATCGGCCTGGG CAAATGGAGATTGTCGTCAGGGCGGCCGAATTGGCGGGCGGGTATTTTCTCTTCACTGCCTGGAAGCCGGGCGGC ATCACGAACCGCGATGCCATTCTCAAGTCGCACGGGATGAAGGTGGTGGACCATCTCGACAAGAAAATTCCTGGG TTCGATAACTACCTCAACGTGGCACGGCCTGTGCTACCTGCCCTGGTTGTCTGTCTGAATCCGCTCGAGAATGCC GTCCTGCTGCACGAGTGCAGCCTCAAGCACGTCCCGACGATTGGCATCATCGATACCGACGCCGACCCATCGTGG GTGACGTACCCTATTCCATGCAACGATGACAGCCTCCGAGCCATGTCTGTCATCTGCGGCGCCCTCGGCAGGGCG GGCGAAAGGGGCACAAAGCGAAGGCTCGAAGAATCAGCCGAAGGAAAAGTAACGTGGGACACACCGCCCGAAATC ATCCGCCACATGAGAAAAGAGGTTGTAGAGGCCGAAGCCAAGCAAGCGCAGGTCATGCAAATGATGGAAATGGAC CACGAGGACTTTAACGAAGAAGAGAAGAAGATTCTTCGGAGCGGAAAGCCCCAGGCTGAAGGGCGCGCAGAGGTC AAGGAGGAGGAGATGCTCGATATGTTGAGCCAGGCGTCTGTCGGACGCGCGGCTGTGGCTGCGGCTATAGCTGCG GCGGCGGTTGACGAGGTTCCGACTGAGGACAAGGACGCAGGAGAGAGGACGCCGCCGCCGCCGTCGGGATCATAG |
Gene | >Ophun1|6842 ATGGCTCCGGCTCTGGTCAAGAGTGCCCTCCGACGGGCGTCTACCGAAGCCGGGCCGAGCAAGAAGCCCAACGCA AGCGAAATCAAGGAGATGGGCATGAAGATGCGAAGCGCTTCTGGATCGCCGAGGATTCCCAACGCGGCCAAGAAG AAGAGACAAGCCGAGGCGCAGAATGGCTTTACCAGCTTGTTAGCGGGCGAACTGCGAAAGCACAAAGGCGAATCG TGGACGAGGTCGCATCAGGTGGGAGACATGATGGTGACGCCGGCGCAGCAGTACGCATTCTTTCAGAAGATTCGG TCGCGGTCGCGTGGCATCGGGTCTGAGGTGTCCAAGCTTTACACCCCCGCGCAGCACATCAACAACCCTCCCTGG CCCGAAGACGTGACGCTGGAGCTGCTGATGGCGTCGCAGACGCACATGGGACACCATACTTCGCTGTGGAATCCG ATCAACTCGCAGTACATCTATGGCATACGCGAGGGCATTCACATCATCTCTCTGGAGGCGACGATGGCGCATCTG CGGCGGGCGGCGAGGGTGATGGAGGGCGTGCTGTACCGCGGCGGCATCGTTCTCTTTGTCGGAAATCGGCCTGGG CAAATGGAGATTGTCGTCAGGGCGGCCGAATTGGCGGGCGGGTATTTTCTCTTCACTGCCTGGAAGCCGGGCGGC ATCACGAACCGCGATGCCATTCTCAAGTCGCACGGGATGAAGGTGGTGGACCATCTCGACAAGAAAATTCCTGGG TTCGATAACTACCTCAACGTGGCACGGCCTGTGCTACCTGCCCTGGTTGTCTGTCTGAATCCGCTCGAGAATGCC GTCCTGCTGCACGAGTGCAGCCTCAAGCACGTCCCGACGATTGGCATCATCGATACCGACGCCGACCCATCGTGG GTGACGTACCCTATTCCATGCAACGATGACAGGTGAGACGCGACGTACCCTTCTAACCGTTACTTTACAGAAGAA GGGTGACGTGAGTTGCTGACGATGGTATCACTCGCACGCAGCCTCCGAGCCATGTCTGTCATCTGCGGCGCCCTC GGCAGGGCGGGCGAAAGGGGCACAAAGCGAAGGCTCGAAGAATCAGCCGAAGGAAAAGTAACGTGGGACACACCG CCCGAAATCATCCGCCACATGAGAAAAGAGGTTGTAGAGGCCGAAGCCAAGCAAGCGCAGGTCATGCAAATGATG GAAATGGACCACGAGGACTTTAACGAAGAAGAGAAGAAGATTCTTCGGAGCGGAAAGCCCCAGGCTGAAGGGCGC GCAGAGGTCAAGGAGGAGGAGATGCTCGATATGTTGAGCCAGGCGTCTGTCGGACGCGCGGCTGTGGCTGCGGCT ATAGCTGCGGCGGCGGTTGACGAGGTTCCGACTGAGGACAAGGACGCAGGAGAGAGGACGCCGCCGCCGCCGTCG GGATCATAG |