Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|684
Gene name
LocationContig_1218:177..3094
Strand-
Gene length (bp)2917
Transcript length (bp)2286
Coding sequence length (bp)2286
Protein length (aa) 762

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 1.2E-113 304 705
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 1.2E-08 711 750
PF16923 Glyco_hydro_63N Glycosyl hydrolase family 63 N-terminal domain 7.3E-76 37 266

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 4 747 1.0E-167
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 9 750 2.0E-133
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 38 749 1.0E-101
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 38 749 7.0E-96
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 38 749 2.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 4 747 1.0E-167
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 9 750 2.0E-133
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 38 749 1.0E-101
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 38 749 7.0E-96
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 38 749 2.0E-91
sp|Q84M89|GCS2_ARATH Alpha-glucosidase 2 OS=Arabidopsis thaliana GN=GCS2 PE=2 SV=1 34 751 3.0E-87
sp|F4HTM3|GCS1_ARATH Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana GN=GCS1 PE=1 SV=1 34 751 4.0E-87
sp|Q19426|MOGS1_CAEEL Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans GN=mogs-1 PE=1 SV=2 35 749 8.0E-75
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999755

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7808
Ophiocordyceps australis map64 (Brazil) OphauB2|8014
Ophiocordyceps camponoti-floridani Ophcf2|05357
Ophiocordyceps camponoti-rufipedis Ophun1|684 (this protein)
Ophiocordyceps kimflemingae Ophio5|8250
Ophiocordyceps subramaniannii Hirsu2|4206

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|684
MARLAGLALLAAAASLVSGSGDESVLAAEINRLNNQSLFWGPYKPNLYFGVRPRVPQALWTGLMWGRMENFEDIK
DGFRYTCEQGKDIPGYGWDEFDARTGGVQTIHDEGNNIDISTSFVKIAGGGHGGSWAARIKGTPRASAPDKLKST
VVYYLAQEGDGDLEPEQQEGSEGGFKSDVLFRGRSNALGSYKMVITNGKGEHPTSDDELSSTRPGDTTVVNSQQL
PDDMIWQAKAVVFQQLQRAAAEVQESTADESQAGPSPWQVYRVPHRPAKGNVHVVQKTFEGPFEFDVLFSSGSSG
VEVTSESATREMARASAAFSDRFQRVFPLQEPFTGEEYVKFGKNMLSNLVGGIGYFYGDQLVDRSYAAEYDEEGE
SFWVEAAEARAQGKQKLEGPYELFTAIPSRSFFPRGFLWDEGFHLLLISDWDLDLGLEVLSSWFATMDEDGWIAR
EQILGAEARSKVPEEFRVQYPHYGNPPTLFLVVDGMLERLQARRNGTSGSSRSSRRLDTDDDGERLYTAHLDNEE
LGWDYLRRLYPLLRRQYDWFRKTQRGEVKSYDRTAYAPKEAYRWRGRTERHCLTSGLDDYPRPQPPHPGELHVDL
LSWMGLMTGTLLRLSEGLGLADEADELRTRLSGLERNAVDLHWSESEGIFCDASVDEFDEHRLVCHRGYVSLMPL
LTGLVDAGDERTGRILEGLGEGGGLWSRFGGIATGTGPFRTRARTLHNELRRNLVRTVYESWRETGFVWEQYGDV
RIRRGNSELGH*
Coding >Ophun1|684
ATGGCTCGACTCGCCGGACTCGCGCTGCTGGCCGCGGCTGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAACCTGTACTTTGGA
GTGCGGCCGAGAGTACCGCAGGCGCTGTGGACGGGATTGATGTGGGGGCGGATGGAGAATTTCGAGGATATCAAG
GATGGTTTTCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACG
GGAGGCGTTCAGACGATTCACGACGAGGGGAATAATATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGGGGT
GGTCATGGCGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGCCGGACAAGCTCAAGTCTACC
GTCGTCTACTATCTCGCCCAGGAGGGAGACGGAGACCTCGAGCCGGAGCAGCAGGAGGGTTCAGAAGGAGGATTC
AAGAGCGACGTCTTGTTTCGGGGACGGTCTAATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGCAAGGGA
GAGCATCCGACCAGCGATGACGAGCTCTCGTCGACGAGACCCGGTGACACGACGGTCGTCAACAGCCAGCAGCTC
CCGGACGACATGATCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCGGCCGAGGTACAAGAG
TCGACGGCGGACGAGAGTCAAGCCGGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGGCCGGCCAAGGGC
AACGTGCACGTGGTGCAGAAGACGTTTGAGGGGCCCTTTGAGTTTGACGTCTTGTTCTCGTCTGGCTCGTCGGGG
GTCGAGGTGACGTCTGAGTCGGCGACGAGGGAGATGGCGAGGGCGTCGGCGGCCTTTTCCGATCGGTTCCAGCGC
GTGTTTCCGCTTCAGGAGCCGTTTACGGGGGAGGAATACGTCAAGTTTGGGAAGAATATGCTCTCGAACCTCGTC
GGGGGCATCGGATACTTTTACGGCGATCAACTGGTTGACCGATCCTATGCGGCCGAGTACGACGAAGAGGGCGAG
TCGTTTTGGGTCGAGGCGGCAGAGGCGCGGGCTCAGGGGAAGCAGAAGCTCGAAGGGCCGTATGAGCTGTTTACG
GCCATTCCTTCACGATCCTTTTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATCTCAGAC
TGGGACTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATCGCTCGG
GAGCAGATTCTGGGAGCCGAGGCTCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCACTACGGGAAC
CCCCCGACGCTGTTTCTCGTGGTCGACGGGATGCTGGAGCGGTTGCAGGCGCGGAGGAACGGGACGAGCGGGTCG
AGCAGGTCGAGCAGGCGGCTAGACACGGACGACGACGGCGAGAGGCTCTATACGGCTCACCTGGACAACGAGGAG
CTCGGATGGGACTACCTGCGACGGCTGTATCCGCTGCTCCGACGACAGTACGACTGGTTCCGCAAGACGCAAAGG
GGAGAGGTCAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGGACGGAGAGG
CACTGCCTGACGAGCGGACTCGACGATTACCCGCGACCACAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTT
CTGTCGTGGATGGGGCTGATGACAGGCACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGGCCGACGAGGCAGAC
GAGCTCCGGACGCGGCTCTCCGGGCTGGAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCGGAGGGCATCTTC
TGCGACGCTTCGGTCGACGAGTTTGACGAGCACCGGCTCGTCTGTCATCGGGGGTACGTCTCGCTGATGCCGCTG
CTTACGGGCCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGCCTCGGGGAGGGGGGGGGTCTC
TGGAGCCGGTTCGGGGGCATCGCCACCGGGACAGGCCCCTTCCGGACGCGCGCCCGGACGCTGCACAACGAGCTT
CGGCGGAACCTGGTGAGGACAGTCTACGAGAGCTGGCGGGAGACGGGCTTCGTGTGGGAGCAGTACGGTGACGTA
CGAATAAGAAGGGGAAACTCGGAACTTGGTCATTAG
Transcript >Ophun1|684
ATGGCTCGACTCGCCGGACTCGCGCTGCTGGCCGCGGCTGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAACCTGTACTTTGGA
GTGCGGCCGAGAGTACCGCAGGCGCTGTGGACGGGATTGATGTGGGGGCGGATGGAGAATTTCGAGGATATCAAG
GATGGTTTTCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACG
GGAGGCGTTCAGACGATTCACGACGAGGGGAATAATATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGGGGT
GGTCATGGCGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGCCGGACAAGCTCAAGTCTACC
GTCGTCTACTATCTCGCCCAGGAGGGAGACGGAGACCTCGAGCCGGAGCAGCAGGAGGGTTCAGAAGGAGGATTC
AAGAGCGACGTCTTGTTTCGGGGACGGTCTAATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGCAAGGGA
GAGCATCCGACCAGCGATGACGAGCTCTCGTCGACGAGACCCGGTGACACGACGGTCGTCAACAGCCAGCAGCTC
CCGGACGACATGATCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCGGCCGAGGTACAAGAG
TCGACGGCGGACGAGAGTCAAGCCGGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGGCCGGCCAAGGGC
AACGTGCACGTGGTGCAGAAGACGTTTGAGGGGCCCTTTGAGTTTGACGTCTTGTTCTCGTCTGGCTCGTCGGGG
GTCGAGGTGACGTCTGAGTCGGCGACGAGGGAGATGGCGAGGGCGTCGGCGGCCTTTTCCGATCGGTTCCAGCGC
GTGTTTCCGCTTCAGGAGCCGTTTACGGGGGAGGAATACGTCAAGTTTGGGAAGAATATGCTCTCGAACCTCGTC
GGGGGCATCGGATACTTTTACGGCGATCAACTGGTTGACCGATCCTATGCGGCCGAGTACGACGAAGAGGGCGAG
TCGTTTTGGGTCGAGGCGGCAGAGGCGCGGGCTCAGGGGAAGCAGAAGCTCGAAGGGCCGTATGAGCTGTTTACG
GCCATTCCTTCACGATCCTTTTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATCTCAGAC
TGGGACTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATCGCTCGG
GAGCAGATTCTGGGAGCCGAGGCTCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCACTACGGGAAC
CCCCCGACGCTGTTTCTCGTGGTCGACGGGATGCTGGAGCGGTTGCAGGCGCGGAGGAACGGGACGAGCGGGTCG
AGCAGGTCGAGCAGGCGGCTAGACACGGACGACGACGGCGAGAGGCTCTATACGGCTCACCTGGACAACGAGGAG
CTCGGATGGGACTACCTGCGACGGCTGTATCCGCTGCTCCGACGACAGTACGACTGGTTCCGCAAGACGCAAAGG
GGAGAGGTCAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGGACGGAGAGG
CACTGCCTGACGAGCGGACTCGACGATTACCCGCGACCACAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTT
CTGTCGTGGATGGGGCTGATGACAGGCACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGGCCGACGAGGCAGAC
GAGCTCCGGACGCGGCTCTCCGGGCTGGAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCGGAGGGCATCTTC
TGCGACGCTTCGGTCGACGAGTTTGACGAGCACCGGCTCGTCTGTCATCGGGGGTACGTCTCGCTGATGCCGCTG
CTTACGGGCCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGCCTCGGGGAGGGGGGGGGTCTC
TGGAGCCGGTTCGGGGGCATCGCCACCGGGACAGGCCCCTTCCGGACGCGCGCCCGGACGCTGCACAACGAGCTT
CGGCGGAACCTGGTGAGGACAGTCTACGAGAGCTGGCGGGAGACGGGCTTCGTGTGGGAGCAGTACGGTGACGTA
CGAATAAGAAGGGGAAACTCGGAACTTGGTCATTAG
Gene >Ophun1|684
ATGGCTCGACTCGCCGGACTCGCGCTGCTGGCCGCGGCTGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAACCTGTACTTTGGA
GTGCGGCCGAGAGTACCGCAGGCGCTGTGGACGGGATTGATGTGGGGGCGGATGGAGAATTTCGAGGATATCAAG
GATGGTGGGTTTGGGGAAGGGCTCGTGAGCTGGTTGGGTTGATGCTGATGCTGATGGTGATGGGTGATGGGCAGG
TTTTCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACGGGAGG
CGTTCAGACGATTCACGACGAGGGGAATAATATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGGGGTGGTCA
TGGCGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGCCGGACAAGCTCAAGTCTACCGTCGT
CTACTATCTCGCCCAGGAGGGAGACGGAGACCTCGAGCCGGAGCAGCAGGAGGGTTCAGAAGGAGGATTCAAGAG
CGACGTCTTGTTTCGGGGACGGTCTAATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGCAAGGGAGAGCA
TCCGACCAGCGATGACGAGCTCTCGTCGACGAGACCCGGTGACACGACGGTCGTCAACAGCCAGCAGCTCCCGGA
CGACATGATCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCGGCCGAGGTACAAGAGTCGAC
GGCGGACGAGAGTCAAGCCGGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGGCCGGCCAAGGGCAACGT
GCACGTGGTGCAGAAGACGTTTGAGGGGCCCTTTGAGTTTGACGTCTTGTTCTCGTCTGGCTCGTCGGGGGTCGA
GGTGACGTCTGAGTCGGCGACGAGGGAGATGGCGAGGGCGTCGGCGGCCTTTTCCGATCGGTTCCAGCGCGTGTT
TCCGCTTCAGGAGCCGTTTACGGGGGAGGAATACGTCAAGTTTGGGAAGAATATGCTCTCGAACCTCGTCGGGGG
CATCGGATACTTTTACGGCGATCAACTGGTTGACCGATCCTATGCGGCCGAGTACGACGAAGAGGGCGAGTCGTT
TTGGGTCGAGGCGGCAGAGGCGCGGGCTCAGGGGAAGCAGAAGCTCGAAGGGCCGTATGAGCTGTTTACGGCCAT
TCCTTCACGATCCTTTTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATCTCAGACTGGGA
CTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATCGCTCGGGAGCA
GATTCTGGGAGCCGAGGCTCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCACTACGGGAACCCCCC
GACGCTGTTTCTCGTGGTCGACGGGATGCTGGAGCGGTTGCAGGCGCGGAGGAACGGGACGAGCGGGTCGAGCAG
GTCGAGCAGGCGGCTAGACACGGACGACGACGGCGAGAGGCTCTATACGGCTCACCTGGACAACGAGGAGCTCGG
ATGGGACTACCTGCGACGGCTGTATCCGCTGCTCCGACGACAGTACGACTGGTTCCGCAAGACGCAAAGGGGAGA
GGTCAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGGACGGAGAGGCACTG
CCTGACGAGCGGACTCGACGATTACCCGCGACCACAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTTCTGTC
GTGGATGGGGCTGATGACAGGCACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGGCCGACGAGGCAGACGAGCT
CCGGACGCGGCTCTCCGGGCTGGAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCGGAGGGCATCTTCTGCGA
CGCTTCGGTCGACGAGTTTGACGAGCACCGGCTCGTCTGTCATCGGGGGTACGTCTCGCTGATGCCGCTGCTTAC
GGGCCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGCCTCGGGGAGGGGGGGGGTCTCTGGAG
CCGGTTCGGGGTGAGGAGCCTGAGTCTTTCGGATGGGCTTTATGGGAGTGGAGAGGATTATTGGAGGGGGGCGGT
TTGGATGCCGGTGAATTGGATGGTGGTTGTGTGGTTGCGGGTGAGTCTTTTCTTTTTCTTTTTTTCTTTCTTTTC
TTCTTATGTTCTTCTTTTGTTTGTTCTTTGCGTCTTGTTGTTGTTGTTGTTGTTGTTCTTCTTCTTCTTCTTCTT
TTTTTGGAAACCATGTTTTATTTTATTTTTCCCTGATTTGTTTTTTTGTTTCGTTGTTATTTCCGGTCTGTTTCG
CCGTCATTTCTGCTGCCTGGTGTTTCCTTTTCCCCGAAGACGGTCGTGTTGGCGATCCGATGACTCCATCTCGGC
TACGCTAACCGAAACGTGCAGGGCATCGCCACCGGGACAGGCCCCTTCCGGACGCGCGCCCGGACGCTGCACAAC
GAGCTTCGGCGGAACCTGGTGAGGACAGTCTACGAGAGCTGGCGGGAGACGGGCTTCGTGTGGGAGCAGTACGGT
GGTGAGGATGGGGGGGGCAGGAGGACGGGGGGGTTTACGGGGTGGACGAGTCTTGTGCTTTCGCTGATGGCTCTG
GGGGATGTATAGACGTACGAATAAGAAGGGGAAGTATGACGCATCGTGGATTTTTTTTGTTCTCATGGTCATGGT
TCATGGTCATGGTTATGACTGGTGCCTGAGGCTGACGGTGCCTGGAGACTCGGAACTTGGTCATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail