Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6830
Gene name
LocationContig_785:232..2849
Strand+
Gene length (bp)2617
Transcript length (bp)2562
Coding sequence length (bp)2562
Protein length (aa) 854

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 1.8E-26 118 229
PF00092 VWA von Willebrand factor type A domain 3.2E-14 304 469
PF13768 VWA_3 von Willebrand factor type A domain 1.7E-12 304 457

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6984
Ophiocordyceps australis map64 (Brazil) OphauB2|5175
Ophiocordyceps camponoti-floridani Ophcf2|06524
Ophiocordyceps camponoti-rufipedis Ophun1|6830 (this protein)
Ophiocordyceps kimflemingae Ophio5|4387
Ophiocordyceps subramaniannii Hirsu2|9461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6830
METSPGSPRPVSRNPIPPPTITVRSEFPTLTRSRQQQTLTCLITVEAASNKWRPDLEDLGVQPLQLPSLEARMDD
ATTRQPVSTPAPLYPYESADVLEEMAENLRTRVDSWHGLIFDDFGPLRLYGTLRVGKNKVSWQVLECYLFAKMLI
CVKEKKQAPQWDDNGIPQRTATVCTLKGSILIKKHLNDVVETGTIDENVLTLTLSAGELPQFHLKFDNRNQLKLW
NQALVDLITDEPSSFRISDYDHEISETEDDVDWNRSRSKRVSSTASSWGPKSATTAPTEYTSFTARSPRLGSPMH
VPIDVVVVVPISSSMQGVKINLVRDALKFMIGNLGERDRLGIVTFGSASGGTPMSGMMTKSYADWPKVLASIKPV
GQKSPRADVVEGANVAMDQLMERKHSNPIATIMLISDASTADPDSVDFVVSRAEAAKITIHSFGLGTSHKPDTMI
ELSTRTKASYTYVKDWMMLRECLAGCLGGLQTLSHQNVKLKLKLPEGSPAKFHKISGALQITKRATGRDAEANLG
DLRFGDKRDVLVQLVITPDSMSQEQLPQDPWDNIVSGLEALGGSVEAEADRIASVEEVPLVQADLSWGDILRDGT
VTHMPRPSLLTVTGLPAPTGQKKAWATNAPPPIPPHPSIVQRRMELLTSDMLTRALTLVSRGQHDRAHTLLNETR
SILKGLGKGGLPPVPPPPLPNSTKSAPTTPHHVGGDATPHAAGTPDRKRSPSPPTSTASSTSSGNSGNGFSAGRL
ARSRSTDHLGGVGRGIDPGTVAALDAELESSLEWINHPAVFARDSRKAVLQAIGVISSQRAFTFRSPIESLWAGR
VGGIKRLADKSREWREEGGGEGGITEEA*
Coding >Ophun1|6830
ATGGAGACGTCCCCCGGCAGCCCGCGTCCCGTCTCGCGGAACCCGATCCCCCCACCCACCATCACCGTCCGCTCC
GAGTTCCCGACTCTCACCAGGTCCCGTCAGCAGCAGACGCTCACCTGCCTCATCACCGTAGAGGCCGCCAGCAAC
AAGTGGAGGCCCGACCTCGAGGACCTTGGCGTTCAGCCGCTGCAGCTACCCTCGCTCGAGGCTCGGATGGACGAC
GCCACGACGCGGCAGCCCGTCTCCACGCCCGCCCCTCTCTATCCCTACGAGTCCGCCGACGTGCTGGAGGAGATG
GCGGAGAACCTGAGAACTCGCGTCGACAGCTGGCACGGGCTTATTTTTGACGATTTCGGACCCCTTCGCCTTTAC
GGTACACTTCGTGTCGGCAAGAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCCAAGATGCTCATC
TGCGTCAAGGAGAAGAAGCAGGCGCCGCAGTGGGACGACAATGGCATCCCTCAGAGGACCGCCACCGTCTGCACG
CTCAAGGGCTCCATACTCATCAAGAAGCACCTCAATGACGTGGTCGAGACGGGCACCATAGACGAGAACGTCCTG
ACCCTGACGCTGTCCGCCGGTGAACTGCCGCAGTTTCACCTCAAGTTCGACAATCGCAACCAGCTCAAGCTCTGG
AACCAGGCGCTGGTGGACCTCATCACCGACGAGCCCTCGTCATTCCGCATCTCCGACTACGACCACGAGATATCA
GAGACGGAAGACGACGTCGACTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCCTCGTCGTGGGGTCCC
AAGTCGGCGACGACGGCGCCCACCGAGTACACGTCATTTACCGCTCGGAGCCCGCGCCTGGGCAGTCCGATGCAC
GTACCCATCGACGTGGTGGTTGTGGTGCCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGCGAC
GCCCTCAAGTTCATGATTGGCAACCTCGGTGAGCGCGACCGGCTCGGCATCGTCACCTTTGGCTCTGCCAGCGGC
GGCACGCCCATGTCGGGCATGATGACCAAGTCGTACGCCGACTGGCCCAAGGTGCTGGCCTCGATAAAGCCTGTC
GGTCAGAAGAGCCCGCGGGCGGACGTGGTCGAGGGCGCCAACGTGGCAATGGACCAGCTCATGGAGCGCAAGCAC
AGCAATCCCATCGCCACCATCATGCTCATCAGCGACGCGTCGACGGCCGATCCGGACTCGGTCGACTTTGTCGTC
TCCCGTGCCGAGGCTGCCAAGATCACCATTCACTCGTTTGGCCTCGGCACGTCGCACAAGCCCGACACCATGATC
GAGCTGTCGACACGGACCAAGGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGCGAGTGCCTGGCCGGC
TGCCTGGGCGGGCTGCAGACGCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTTCCCGAGGGATCGCCGGCC
AAGTTCCACAAAATCAGCGGCGCGCTGCAGATCACGAAGCGCGCCACGGGCCGCGACGCCGAGGCCAACCTGGGA
GACCTGCGCTTCGGCGACAAGCGCGACGTGTTGGTGCAGCTCGTCATCACGCCGGACAGCATGTCGCAGGAGCAG
CTACCCCAGGACCCGTGGGATAACATTGTCTCCGGGCTCGAGGCCCTCGGGGGCTCTGTCGAAGCCGAGGCCGAC
CGCATCGCCTCGGTCGAAGAGGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATCCTGCGCGACGGCACA
GTGACGCACATGCCGCGGCCGTCGCTGCTGACGGTGACGGGTCTCCCGGCTCCGACGGGCCAGAAGAAGGCCTGG
GCCACCAACGCACCGCCTCCGATCCCGCCGCACCCCAGCATCGTCCAGCGGCGCATGGAGCTATTGACGTCGGAC
ATGCTGACGCGCGCCCTGACGCTCGTAAGCCGCGGCCAGCACGATCGGGCGCATACGCTGCTCAACGAGACGCGG
TCCATTCTCAAGGGCCTCGGCAAGGGCGGTCTGCCACCGGTGCCACCGCCTCCGCTGCCCAACAGCACCAAGTCG
GCGCCGACGACGCCACACCACGTCGGCGGAGATGCGACGCCCCACGCGGCCGGCACCCCGGACCGGAAGCGGAGC
CCGTCGCCGCCCACATCCACGGCCTCTTCGACGAGCAGCGGCAACAGCGGCAACGGCTTCTCGGCCGGCCGGCTC
GCCCGCAGCCGCTCTACCGACCACCTCGGCGGCGTCGGCAGGGGCATCGACCCGGGAACGGTGGCGGCGCTCGAC
GCCGAGCTGGAGAGCAGCCTCGAATGGATCAACCACCCGGCCGTCTTCGCTCGCGACAGCCGCAAGGCGGTCCTC
CAGGCCATCGGCGTCATCAGCTCGCAGCGGGCCTTTACCTTCCGGTCCCCCATCGAGAGCCTCTGGGCCGGCCGC
GTCGGCGGCATCAAGCGACTGGCGGACAAGAGCCGCGAATGGCGAGAAGAGGGCGGCGGCGAGGGCGGCATCACG
GAGGAGGCTTGA
Transcript >Ophun1|6830
ATGGAGACGTCCCCCGGCAGCCCGCGTCCCGTCTCGCGGAACCCGATCCCCCCACCCACCATCACCGTCCGCTCC
GAGTTCCCGACTCTCACCAGGTCCCGTCAGCAGCAGACGCTCACCTGCCTCATCACCGTAGAGGCCGCCAGCAAC
AAGTGGAGGCCCGACCTCGAGGACCTTGGCGTTCAGCCGCTGCAGCTACCCTCGCTCGAGGCTCGGATGGACGAC
GCCACGACGCGGCAGCCCGTCTCCACGCCCGCCCCTCTCTATCCCTACGAGTCCGCCGACGTGCTGGAGGAGATG
GCGGAGAACCTGAGAACTCGCGTCGACAGCTGGCACGGGCTTATTTTTGACGATTTCGGACCCCTTCGCCTTTAC
GGTACACTTCGTGTCGGCAAGAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCCAAGATGCTCATC
TGCGTCAAGGAGAAGAAGCAGGCGCCGCAGTGGGACGACAATGGCATCCCTCAGAGGACCGCCACCGTCTGCACG
CTCAAGGGCTCCATACTCATCAAGAAGCACCTCAATGACGTGGTCGAGACGGGCACCATAGACGAGAACGTCCTG
ACCCTGACGCTGTCCGCCGGTGAACTGCCGCAGTTTCACCTCAAGTTCGACAATCGCAACCAGCTCAAGCTCTGG
AACCAGGCGCTGGTGGACCTCATCACCGACGAGCCCTCGTCATTCCGCATCTCCGACTACGACCACGAGATATCA
GAGACGGAAGACGACGTCGACTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCCTCGTCGTGGGGTCCC
AAGTCGGCGACGACGGCGCCCACCGAGTACACGTCATTTACCGCTCGGAGCCCGCGCCTGGGCAGTCCGATGCAC
GTACCCATCGACGTGGTGGTTGTGGTGCCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGCGAC
GCCCTCAAGTTCATGATTGGCAACCTCGGTGAGCGCGACCGGCTCGGCATCGTCACCTTTGGCTCTGCCAGCGGC
GGCACGCCCATGTCGGGCATGATGACCAAGTCGTACGCCGACTGGCCCAAGGTGCTGGCCTCGATAAAGCCTGTC
GGTCAGAAGAGCCCGCGGGCGGACGTGGTCGAGGGCGCCAACGTGGCAATGGACCAGCTCATGGAGCGCAAGCAC
AGCAATCCCATCGCCACCATCATGCTCATCAGCGACGCGTCGACGGCCGATCCGGACTCGGTCGACTTTGTCGTC
TCCCGTGCCGAGGCTGCCAAGATCACCATTCACTCGTTTGGCCTCGGCACGTCGCACAAGCCCGACACCATGATC
GAGCTGTCGACACGGACCAAGGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGCGAGTGCCTGGCCGGC
TGCCTGGGCGGGCTGCAGACGCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTTCCCGAGGGATCGCCGGCC
AAGTTCCACAAAATCAGCGGCGCGCTGCAGATCACGAAGCGCGCCACGGGCCGCGACGCCGAGGCCAACCTGGGA
GACCTGCGCTTCGGCGACAAGCGCGACGTGTTGGTGCAGCTCGTCATCACGCCGGACAGCATGTCGCAGGAGCAG
CTACCCCAGGACCCGTGGGATAACATTGTCTCCGGGCTCGAGGCCCTCGGGGGCTCTGTCGAAGCCGAGGCCGAC
CGCATCGCCTCGGTCGAAGAGGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATCCTGCGCGACGGCACA
GTGACGCACATGCCGCGGCCGTCGCTGCTGACGGTGACGGGTCTCCCGGCTCCGACGGGCCAGAAGAAGGCCTGG
GCCACCAACGCACCGCCTCCGATCCCGCCGCACCCCAGCATCGTCCAGCGGCGCATGGAGCTATTGACGTCGGAC
ATGCTGACGCGCGCCCTGACGCTCGTAAGCCGCGGCCAGCACGATCGGGCGCATACGCTGCTCAACGAGACGCGG
TCCATTCTCAAGGGCCTCGGCAAGGGCGGTCTGCCACCGGTGCCACCGCCTCCGCTGCCCAACAGCACCAAGTCG
GCGCCGACGACGCCACACCACGTCGGCGGAGATGCGACGCCCCACGCGGCCGGCACCCCGGACCGGAAGCGGAGC
CCGTCGCCGCCCACATCCACGGCCTCTTCGACGAGCAGCGGCAACAGCGGCAACGGCTTCTCGGCCGGCCGGCTC
GCCCGCAGCCGCTCTACCGACCACCTCGGCGGCGTCGGCAGGGGCATCGACCCGGGAACGGTGGCGGCGCTCGAC
GCCGAGCTGGAGAGCAGCCTCGAATGGATCAACCACCCGGCCGTCTTCGCTCGCGACAGCCGCAAGGCGGTCCTC
CAGGCCATCGGCGTCATCAGCTCGCAGCGGGCCTTTACCTTCCGGTCCCCCATCGAGAGCCTCTGGGCCGGCCGC
GTCGGCGGCATCAAGCGACTGGCGGACAAGAGCCGCGAATGGCGAGAAGAGGGCGGCGGCGAGGGCGGCATCACG
GAGGAGGCTTGA
Gene >Ophun1|6830
ATGGAGACGTCCCCCGGCAGCCCGCGTCCCGTCTCGCGGAACCCGATCCCCCCACCCACCATCACCGTCCGCTCC
GAGTTCCCGACTCTCACCAGGTCCCGTCAGCAGCAGACGCTCACCTGCCTCATCACCGTAGAGGCCGCCAGCAAC
AAGTGGAGGCCCGACCTCGAGGACCTTGGCGTTCAGCCGCTGCAGCTACCCTCGCTCGAGGCTCGGATGGACGAC
GCCACGACGCGGCAGCCCGTCTCCACGCCCGCCCCTCTCTATCCCTACGAGTCCGCCGACGTGCTGGAGGAGATG
GCGGAGAACCTGAGAACTCGCGTCGACAGCTGGCACGGGCTTATTTTTGACGAGTAAGCGTCTTTGACACCTTGC
ACACGTTCCTACCCGTAACTGACCTGTTCAAAGTTTCGGACCCCTTCGCCTTTACGGTACACTTCGTGTCGGCAA
GAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCCAAGATGCTCATCTGCGTCAAGGAGAAGAAGCA
GGCGCCGCAGTGGGACGACAATGGCATCCCTCAGAGGACCGCCACCGTCTGCACGCTCAAGGGCTCCATACTCAT
CAAGAAGCACCTCAATGACGTGGTCGAGACGGGCACCATAGACGAGAACGTCCTGACCCTGACGCTGTCCGCCGG
TGAACTGCCGCAGTTTCACCTCAAGTTCGACAATCGCAACCAGCTCAAGCTCTGGAACCAGGCGCTGGTGGACCT
CATCACCGACGAGCCCTCGTCATTCCGCATCTCCGACTACGACCACGAGATATCAGAGACGGAAGACGACGTCGA
CTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCCTCGTCGTGGGGTCCCAAGTCGGCGACGACGGCGCC
CACCGAGTACACGTCATTTACCGCTCGGAGCCCGCGCCTGGGCAGTCCGATGCACGTACCCATCGACGTGGTGGT
TGTGGTGCCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAACCTGGTGCGCGACGCCCTCAAGTTCATGATTGG
CAACCTCGGTGAGCGCGACCGGCTCGGCATCGTCACCTTTGGCTCTGCCAGCGGCGGCACGCCCATGTCGGGCAT
GATGACCAAGTCGTACGCCGACTGGCCCAAGGTGCTGGCCTCGATAAAGCCTGTCGGTCAGAAGAGCCCGCGGGC
GGACGTGGTCGAGGGCGCCAACGTGGCAATGGACCAGCTCATGGAGCGCAAGCACAGCAATCCCATCGCCACCAT
CATGCTCATCAGCGACGCGTCGACGGCCGATCCGGACTCGGTCGACTTTGTCGTCTCCCGTGCCGAGGCTGCCAA
GATCACCATTCACTCGTTTGGCCTCGGCACGTCGCACAAGCCCGACACCATGATCGAGCTGTCGACACGGACCAA
GGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGCGAGTGCCTGGCCGGCTGCCTGGGCGGGCTGCAGAC
GCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTTCCCGAGGGATCGCCGGCCAAGTTCCACAAAATCAGCGG
CGCGCTGCAGATCACGAAGCGCGCCACGGGCCGCGACGCCGAGGCCAACCTGGGAGACCTGCGCTTCGGCGACAA
GCGCGACGTGTTGGTGCAGCTCGTCATCACGCCGGACAGCATGTCGCAGGAGCAGCTACCCCAGGACCCGTGGGA
TAACATTGTCTCCGGGCTCGAGGCCCTCGGGGGCTCTGTCGAAGCCGAGGCCGACCGCATCGCCTCGGTCGAAGA
GGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATCCTGCGCGACGGCACAGTGACGCACATGCCGCGGCC
GTCGCTGCTGACGGTGACGGGTCTCCCGGCTCCGACGGGCCAGAAGAAGGCCTGGGCCACCAACGCACCGCCTCC
GATCCCGCCGCACCCCAGCATCGTCCAGCGGCGCATGGAGCTATTGACGTCGGACATGCTGACGCGCGCCCTGAC
GCTCGTAAGCCGCGGCCAGCACGATCGGGCGCATACGCTGCTCAACGAGACGCGGTCCATTCTCAAGGGCCTCGG
CAAGGGCGGTCTGCCACCGGTGCCACCGCCTCCGCTGCCCAACAGCACCAAGTCGGCGCCGACGACGCCACACCA
CGTCGGCGGAGATGCGACGCCCCACGCGGCCGGCACCCCGGACCGGAAGCGGAGCCCGTCGCCGCCCACATCCAC
GGCCTCTTCGACGAGCAGCGGCAACAGCGGCAACGGCTTCTCGGCCGGCCGGCTCGCCCGCAGCCGCTCTACCGA
CCACCTCGGCGGCGTCGGCAGGGGCATCGACCCGGGAACGGTGGCGGCGCTCGACGCCGAGCTGGAGAGCAGCCT
CGAATGGATCAACCACCCGGCCGTCTTCGCTCGCGACAGCCGCAAGGCGGTCCTCCAGGCCATCGGCGTCATCAG
CTCGCAGCGGGCCTTTACCTTCCGGTCCCCCATCGAGAGCCTCTGGGCCGGCCGCGTCGGCGGCATCAAGCGACT
GGCGGACAAGAGCCGCGAATGGCGAGAAGAGGGCGGCGGCGAGGGCGGCATCACGGAGGAGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail