Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6818
Gene name
LocationContig_780:1189..2804
Strand-
Gene length (bp)1615
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 4.4E-12 335 377
PF17123 zf-RING_11 RING-like zinc finger 1.2E-10 335 362
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.1E-06 335 376
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.8E-06 335 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 312 385 7.0E-13
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 335 381 1.0E-12
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 327 408 4.0E-12
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 320 385 5.0E-12
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 330 383 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 312 385 7.0E-13
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 335 381 1.0E-12
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 327 408 4.0E-12
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 320 385 5.0E-12
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 330 383 9.0E-12
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 327 381 1.0E-11
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 335 426 1.0E-11
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 335 423 2.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 335 422 2.0E-11
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 335 409 2.0E-11
sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 296 391 2.0E-11
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 327 383 2.0E-11
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 335 401 5.0E-11
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 323 382 5.0E-11
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 335 380 7.0E-11
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 325 385 9.0E-11
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 314 387 1.0E-10
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 305 379 1.0E-10
sp|Q8H7N9|ATL31_ORYSJ E3 ubiquitin-protein ligase Os03g0188200 OS=Oryza sativa subsp. japonica GN=Os03g0188200 PE=2 SV=1 315 380 2.0E-10
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 335 384 2.0E-10
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 335 384 2.0E-10
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 335 384 2.0E-10
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 311 379 2.0E-10
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 314 387 3.0E-10
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 335 380 3.0E-10
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 335 402 3.0E-10
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 333 387 4.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 318 377 4.0E-10
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 308 380 4.0E-10
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 308 380 4.0E-10
sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 335 380 4.0E-10
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 335 380 5.0E-10
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 314 398 6.0E-10
sp|Q14B02|RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus GN=Rnf133 PE=1 SV=1 335 395 6.0E-10
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 305 379 7.0E-10
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 308 380 7.0E-10
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 311 379 7.0E-10
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 335 380 8.0E-10
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 333 387 9.0E-10
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 325 385 1.0E-09
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 335 411 1.0E-09
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 327 381 1.0E-09
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 335 377 2.0E-09
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 335 380 2.0E-09
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 335 377 2.0E-09
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 316 380 2.0E-09
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 334 402 2.0E-09
sp|Q9Y6U7|RN215_HUMAN RING finger protein 215 OS=Homo sapiens GN=RNF215 PE=3 SV=2 329 386 2.0E-09
sp|Q9Y252|RNF6_HUMAN E3 ubiquitin-protein ligase RNF6 OS=Homo sapiens GN=RNF6 PE=1 SV=1 305 377 2.0E-09
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 316 380 2.0E-09
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 335 377 2.0E-09
sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 333 377 3.0E-09
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 316 380 3.0E-09
sp|Q9FG21|ATL71_ARATH Putative RING-H2 finger protein ATL71 OS=Arabidopsis thaliana GN=ATL71 PE=3 SV=1 335 377 3.0E-09
sp|Q9DBU5|RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus GN=Rnf6 PE=1 SV=1 305 377 3.0E-09
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 328 380 3.0E-09
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 334 380 4.0E-09
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 335 380 4.0E-09
sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 335 383 4.0E-09
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 335 380 4.0E-09
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 335 393 5.0E-09
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 335 380 5.0E-09
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 335 380 5.0E-09
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 311 379 6.0E-09
sp|Q5SPX3|RN215_MOUSE RING finger protein 215 OS=Mus musculus GN=Rnf215 PE=2 SV=1 335 380 6.0E-09
sp|Q8WVZ7|RN133_HUMAN E3 ubiquitin-protein ligase RNF133 OS=Homo sapiens GN=RNF133 PE=2 SV=1 335 380 7.0E-09
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 315 401 7.0E-09
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 327 380 8.0E-09
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 327 380 9.0E-09
sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 305 409 1.0E-08
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 335 380 1.0E-08
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 335 380 1.0E-08
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 335 380 1.0E-08
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 335 380 1.0E-08
sp|Q8LBA0|NIPL2_ARATH NEP1-interacting protein-like 2 OS=Arabidopsis thaliana GN=ATL24 PE=1 SV=2 335 377 1.0E-08
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 316 380 1.0E-08
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 316 380 1.0E-08
sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 329 393 1.0E-08
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 316 380 1.0E-08
sp|Q5NCP0|RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus GN=Rnf43 PE=2 SV=1 335 380 2.0E-08
sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 335 380 2.0E-08
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 324 384 2.0E-08
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 329 379 2.0E-08
sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 335 380 2.0E-08
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 311 379 2.0E-08
sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 335 380 2.0E-08
sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 335 380 2.0E-08
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 335 380 2.0E-08
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 330 411 2.0E-08
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 335 380 2.0E-08
sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 335 380 2.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 328 377 2.0E-08
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 335 380 2.0E-08
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 288 382 2.0E-08
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 328 377 3.0E-08
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 333 382 3.0E-08
sp|Q9FL42|ATL69_ARATH Putative RING-H2 finger protein ATL69 OS=Arabidopsis thaliana GN=ATL69 PE=3 SV=1 335 384 3.0E-08
sp|Q9LZV8|ATL74_ARATH RING-H2 finger protein ATL74 OS=Arabidopsis thaliana GN=ATL74 PE=2 SV=1 335 380 3.0E-08
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 328 377 3.0E-08
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 328 377 3.0E-08
sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 305 377 4.0E-08
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 335 380 4.0E-08
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 328 377 4.0E-08
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 335 380 4.0E-08
sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 304 377 5.0E-08
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 321 391 6.0E-08
sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 333 404 6.0E-08
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 317 382 6.0E-08
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 335 380 7.0E-08
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 331 380 9.0E-08
sp|Q9M0R6|ATL35_ARATH Putative RING-H2 finger protein ATL35 OS=Arabidopsis thaliana GN=ATL35 PE=3 SV=1 331 383 9.0E-08
sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 305 380 9.0E-08
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 331 386 1.0E-07
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 317 382 1.0E-07
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 304 377 1.0E-07
sp|Q9SJJ7|ATL57_ARATH RING-H2 finger protein ATL57 OS=Arabidopsis thaliana GN=ATL57 PE=2 SV=1 335 377 1.0E-07
sp|Q570X5|ATL58_ARATH RING-H2 finger protein ATL58 OS=Arabidopsis thaliana GN=ATL58 PE=2 SV=1 335 393 2.0E-07
sp|Q9LS99|ATL77_ARATH RING-H2 finger protein ATL77 OS=Arabidopsis thaliana GN=ATL77 PE=2 SV=1 335 377 2.0E-07
sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 335 377 2.0E-07
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 300 380 2.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 335 380 2.0E-07
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 335 380 2.0E-07
sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 335 377 3.0E-07
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 328 377 3.0E-07
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 331 385 3.0E-07
sp|P0CH01|AT21A_ARATH Putative RING-H2 finger protein ATL21A OS=Arabidopsis thaliana GN=ATL21A PE=3 SV=1 305 387 3.0E-07
sp|Q9M0C3|ATL14_ARATH RING-H2 finger protein ATL14 OS=Arabidopsis thaliana GN=ATL14 PE=2 SV=1 335 377 3.0E-07
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 333 395 4.0E-07
sp|G3X9R7|RN148_MOUSE RING finger protein 148 OS=Mus musculus GN=Rnf148 PE=2 SV=1 325 380 4.0E-07
sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=1 SV=2 302 410 5.0E-07
sp|Q0IJ20|RN145_XENTR RING finger protein 145 OS=Xenopus tropicalis GN=rnf145 PE=2 SV=1 316 403 5.0E-07
sp|Q86Y13|DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens GN=DZIP3 PE=1 SV=2 335 378 5.0E-07
sp|Q7TPV2|DZIP3_MOUSE E3 ubiquitin-protein ligase DZIP3 OS=Mus musculus GN=Dzip3 PE=1 SV=2 335 378 6.0E-07
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 335 380 6.0E-07
sp|Q9XF63|ATL3_ARATH RING-H2 finger protein ATL3 OS=Arabidopsis thaliana GN=ATL3 PE=2 SV=1 290 377 6.0E-07
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 335 384 6.0E-07
sp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL54 OS=Arabidopsis thaliana GN=ATL54 PE=2 SV=2 306 377 6.0E-07
sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 333 386 7.0E-07
sp|Q6NKR1|ATL28_ARATH RING-H2 finger protein ATL28 OS=Arabidopsis thaliana GN=ATL28 PE=2 SV=1 335 388 7.0E-07
sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus GN=Rnf122 PE=2 SV=1 335 395 8.0E-07
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 335 383 8.0E-07
sp|Q9SUS5|RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B OS=Arabidopsis thaliana GN=RHA1B PE=2 SV=1 310 396 8.0E-07
sp|Q2TA44|RN148_BOVIN RING finger protein 148 OS=Bos taurus GN=RNF148 PE=2 SV=1 327 380 9.0E-07
sp|Q9QYK7|RNF11_MOUSE RING finger protein 11 OS=Mus musculus GN=Rnf11 PE=1 SV=1 335 376 1.0E-06
sp|Q9Y3C5|RNF11_HUMAN RING finger protein 11 OS=Homo sapiens GN=RNF11 PE=1 SV=1 335 376 1.0E-06
sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus GN=RNF11 PE=2 SV=1 335 376 1.0E-06
sp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1 333 378 1.0E-06
sp|Q9D9X6|ZSWM2_MOUSE E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus GN=Zswim2 PE=1 SV=1 335 375 1.0E-06
sp|Q940Q4|ATL13_ARATH RING-H2 finger protein ATL13 OS=Arabidopsis thaliana GN=ATL13 PE=2 SV=2 333 377 1.0E-06
sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens GN=RNF122 PE=2 SV=2 335 395 1.0E-06
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 325 380 1.0E-06
sp|Q6NML0|ATL76_ARATH E3 ubiquitin-protein ligase ATL76 OS=Arabidopsis thaliana GN=ATL76 PE=1 SV=1 335 377 1.0E-06
sp|Q9ZV51|ATL56_ARATH RING-H2 finger protein ATL56 OS=Arabidopsis thaliana GN=ATL56 PE=2 SV=1 335 381 2.0E-06
sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 333 382 2.0E-06
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 335 380 2.0E-06
sp|Q8NEG5|ZSWM2_HUMAN E3 ubiquitin-protein ligase ZSWIM2 OS=Homo sapiens GN=ZSWIM2 PE=1 SV=2 335 375 2.0E-06
sp|Q7XTV7|HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica GN=HIP1 PE=1 SV=2 335 377 2.0E-06
sp|P0C034|ATL10_ARATH RING-H2 finger protein ATL10 OS=Arabidopsis thaliana GN=ATL10 PE=2 SV=1 335 377 2.0E-06
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 335 391 2.0E-06
sp|O82353|ATL67_ARATH RING-H2 finger protein ATL67 OS=Arabidopsis thaliana GN=ATL67 PE=2 SV=1 335 395 2.0E-06
sp|Q9M313|ATL68_ARATH RING-H2 finger protein ATL68 OS=Arabidopsis thaliana GN=ATL68 PE=2 SV=1 327 409 2.0E-06
sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 335 378 3.0E-06
sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 335 378 3.0E-06
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 333 377 3.0E-06
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 322 380 3.0E-06
sp|Q9C919|ATL19_ARATH Putative RING-H2 finger protein ATL19 OS=Arabidopsis thaliana GN=ATL19 PE=3 SV=1 335 380 4.0E-06
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 335 377 4.0E-06
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 335 391 4.0E-06
sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 335 377 6.0E-06
sp|Q9SKK8|ATL22_ARATH RING-H2 finger protein ATL22 OS=Arabidopsis thaliana GN=ATL22 PE=2 SV=2 305 385 6.0E-06
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 335 453 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 187 209 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6818
MASAAATISAEKDVPEWASSNALQLTLSSKPGLQFTTIPLTENLGLNESDHVRGIVRIYGALRPANVSNYNQITS
HDDIAYLSCDKPSGDNLISPDKMLNDLMAQRPKAILLYSTSRNWCAVNSPEPLAYTSILTMADAGEAGNVQSYLN
SETAVNAIIQGNATEEQTVNNDSGGGGGGNNSAVAMSILYSITGLITLLFLIIIATGAIRAHRYPERYGPRGAFG
GRPRQSRAKGLARAVLDTIPIVKFGNQQPSKPDPQLELETTATVGPANGRTLSRLPEIRPAVADAPPPRPSPSPR
RFSHDSLVSALTVSDVEEADAVPAAVDDDDGQLGCSICTEDFRVGEDVRVLPCNHQFHPNCVDPWLVNVSGTCPL
CRLDLRPGRDSAGSGSPVDEGEFLAPPLALEAEDGGSGSGSGSGSQHHGNRLSRLLDVNRLRQAPMEERMATLRQ
MRTRDGEWTTGGRAHGQSLTDKLKDKFLIRTRSQAEHRRRP*
Coding >Ophun1|6818
ATGGCTTCTGCTGCGGCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTT
ACGCTCTCGTCCAAGCCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAATCTCGGTCTTAACGAGTCGGAT
CACGTTCGCGGAATTGTTCGCATCTATGGAGCTCTGAGGCCGGCCAACGTCTCCAACTACAACCAAATCACGAGC
CATGATGATATCGCCTATCTCTCGTGCGACAAGCCCAGCGGCGATAACCTCATCAGCCCCGACAAGATGCTCAAC
GACCTCATGGCCCAGCGCCCCAAGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCC
GAACCTCTTGCCTACACCAGCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAATGTCCAGAGCTACCTCAAC
TCCGAGACGGCCGTCAACGCCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAATAACGACTCGGGCGGC
GGCGGCGGCGGCAACAACTCGGCCGTGGCCATGAGCATCCTCTACAGCATCACCGGCCTCATCACCCTCCTCTTC
CTCATCATCATCGCCACCGGCGCCATCCGCGCCCACCGTTACCCGGAGAGGTACGGCCCACGGGGCGCCTTTGGG
GGCAGACCTCGCCAGAGCCGGGCCAAGGGGCTTGCCCGTGCCGTCCTCGACACCATCCCCATCGTCAAGTTTGGC
AACCAGCAGCCGTCCAAGCCGGATCCCCAGCTCGAGCTCGAGACGACGGCCACGGTCGGTCCCGCCAACGGCCGC
ACTCTCTCACGCCTGCCCGAGATCAGGCCGGCCGTGGCGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGA
CGATTCAGCCACGACAGCCTCGTGTCGGCCCTGACGGTGTCCGACGTGGAGGAGGCTGACGCCGTGCCCGCCGCC
GTCGACGACGACGACGGCCAGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTG
CTACCGTGCAACCATCAGTTCCATCCCAACTGCGTCGATCCGTGGCTCGTCAACGTGTCCGGCACATGCCCACTC
TGTCGACTGGACCTGAGGCCGGGTCGCGACAGTGCCGGCAGCGGCTCGCCCGTGGACGAGGGCGAATTCCTGGCG
CCGCCGCTGGCTCTCGAGGCGGAAGACGGCGGGTCCGGCTCCGGCTCCGGCTCCGGCTCTCAGCACCACGGCAAC
CGGCTCTCGCGCCTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGCATGGCGACGCTGCGGCAG
ATGCGGACGCGCGACGGCGAGTGGACGACGGGCGGACGGGCGCATGGCCAGAGCCTGACGGACAAGCTCAAGGAC
AAGTTCCTGATCCGCACCAGGTCTCAGGCGGAGCATCGCAGGCGCCCGTAG
Transcript >Ophun1|6818
ATGGCTTCTGCTGCGGCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTT
ACGCTCTCGTCCAAGCCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAATCTCGGTCTTAACGAGTCGGAT
CACGTTCGCGGAATTGTTCGCATCTATGGAGCTCTGAGGCCGGCCAACGTCTCCAACTACAACCAAATCACGAGC
CATGATGATATCGCCTATCTCTCGTGCGACAAGCCCAGCGGCGATAACCTCATCAGCCCCGACAAGATGCTCAAC
GACCTCATGGCCCAGCGCCCCAAGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCC
GAACCTCTTGCCTACACCAGCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAATGTCCAGAGCTACCTCAAC
TCCGAGACGGCCGTCAACGCCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAATAACGACTCGGGCGGC
GGCGGCGGCGGCAACAACTCGGCCGTGGCCATGAGCATCCTCTACAGCATCACCGGCCTCATCACCCTCCTCTTC
CTCATCATCATCGCCACCGGCGCCATCCGCGCCCACCGTTACCCGGAGAGGTACGGCCCACGGGGCGCCTTTGGG
GGCAGACCTCGCCAGAGCCGGGCCAAGGGGCTTGCCCGTGCCGTCCTCGACACCATCCCCATCGTCAAGTTTGGC
AACCAGCAGCCGTCCAAGCCGGATCCCCAGCTCGAGCTCGAGACGACGGCCACGGTCGGTCCCGCCAACGGCCGC
ACTCTCTCACGCCTGCCCGAGATCAGGCCGGCCGTGGCGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGA
CGATTCAGCCACGACAGCCTCGTGTCGGCCCTGACGGTGTCCGACGTGGAGGAGGCTGACGCCGTGCCCGCCGCC
GTCGACGACGACGACGGCCAGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTG
CTACCGTGCAACCATCAGTTCCATCCCAACTGCGTCGATCCGTGGCTCGTCAACGTGTCCGGCACATGCCCACTC
TGTCGACTGGACCTGAGGCCGGGTCGCGACAGTGCCGGCAGCGGCTCGCCCGTGGACGAGGGCGAATTCCTGGCG
CCGCCGCTGGCTCTCGAGGCGGAAGACGGCGGGTCCGGCTCCGGCTCCGGCTCCGGCTCTCAGCACCACGGCAAC
CGGCTCTCGCGCCTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGCATGGCGACGCTGCGGCAG
ATGCGGACGCGCGACGGCGAGTGGACGACGGGCGGACGGGCGCATGGCCAGAGCCTGACGGACAAGCTCAAGGAC
AAGTTCCTGATCCGCACCAGGTCTCAGGCGGAGCATCGCAGGCGCCCGTAG
Gene >Ophun1|6818
ATGGCTTCTGCTGCGGCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTT
ACGCTCTCGTCCAAGCCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAATCTCGGTCTTAACGAGTCGGAT
CACGTTCGCGGAGTGAGTCCTTTTCCCTCTTGTCGATGAGAACAGCAAGACGCTGACTCGATGAAAAGATTGTTC
GCATCTATGGAGCTCTGAGGCCGGCCAACGTCTCCAACTACAACCAAATCACGAGCCATGATGATATCGCCTATC
TCTCGTGCGACAAGCCCAGCGGCGATAACCTCATCAGCCCCGACAAGATGCTCAACGACCTCATGGCCCAGCGCC
CCAAGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCCGAACCTCTTGCCTACACCA
GCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAATGTCCAGAGCTACCTCAACTCCGAGACGGCCGTCAACG
CCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAATAACGACTCGGGCGGCGGCGGCGGCGGCAACAACT
CGGCCGTGGCCATGAGCATCCTCTACAGCATCACCGGCCTCATCACCCTCCTCTTCCTCATCATCATCGCCACCG
GCGCCATCCGCGCCCACCGTTACCCGGAGAGGTACGGCCCACGGGGCGCCTTTGGGGGCAGACCTCGCCAGAGCC
GGGCCAAGGGGCTTGCCCGTGCCGTCCTCGACACCATCCCCATCGTCAAGTTTGGCAACCAGCAGCCGTCCAAGC
CGGATCCCCAGCTCGAGCTCGAGACGACGGCCACGGTCGGTCCCGCCAACGGCCGCACTCTCTCACGCCTGCCCG
AGATCAGGCCGGCCGTGGCGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGACGATTCAGCCACGACAGCC
TCGTGTCGGCCCTGACGGTGTCCGACGTGGAGGAGGCTGACGCCGTGCCCGCCGCCGTCGACGACGACGACGGCC
AGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTGCTACCGTGCAACCATCAGT
TCCATCCCAACTGCGTCGATCCGTGGCTCGTCAACGTGTCCGGCACATGCCCACTCTGGTATGTCTCTTGTCTCT
CCCTTTCCCCTTGCCTGACCCCTCGAGTTTGTCTCACGTATCCGTACTAACATGGTGCCGTCTCAGTCGACTGGA
CCTGAGGCCGGGTCGCGACAGTGCCGGCAGCGGCTCGCCCGTGGACGAGGGCGAATTCCTGGCGCCGCCGCTGGC
TCTCGAGGCGGAAGACGGCGGGTCCGGCTCCGGCTCCGGCTCCGGCTCTCAGCACCACGGCAACCGGCTCTCGCG
CCTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGCATGGCGACGCTGCGGCAGATGCGGACGCG
CGACGGCGAGTGGACGACGGGCGGACGGGCGCATGGCCAGAGCCTGACGGACAAGCTCAAGGACAAGTTCCTGAT
CCGCACCAGGTCTCAGGCGGAGCATCGCAGGCGCCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail