Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6815
Gene name
LocationContig_78:33079..34723
Strand-
Gene length (bp)1644
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 8.5E-99 128 434

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV8|YBL3_SCHPO UPF0744 protein C106.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.03 PE=1 SV=1 116 371 6.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 89 106 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6815
MSADDQYFLDQLSGIPVQVGRFAGDVGDFVDRNVDRASLFFRDNLAGYSWIPESIRPNPVVRPSTSAAAAAAASS
RLELAQRWVARHKFITGLILVVCGSVAYTGYQRSLRRWPRKARRAKRARNGGRVDVVVVAGSPTLPLTKSLSLDL
ERRGFVVFVVCNAAEDENLVHAFSRPDIRPLTIDTTDPPRAGAAIERFARYLQSPQAPGPTVKPNLLTLKSVILI
PSLHYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTSRLNPVGEKWIPPKVLVFTPSIISSINPPFHAPE
ATVCSALSAFTEVLTAELGPLDIPVTHVQLGTFDFSGFSATGRSYGPLVPATPHETLVWPDGARHVYGRNYVAQN
TSAISGGRIGGFKGSSLRCLHTTVFDVIDGSITSHSVRVGLGAGIYGFVGRWAPRGLVSWMMGIRRVDELSTWKA
SLDDSAGCSPCGEDDGEDPATALSHEFIAVPSEGNVWNTETAESSLWVPSVSETS*
Coding >Ophun1|6815
ATGTCCGCCGACGATCAGTACTTTCTTGATCAGCTCTCCGGCATCCCCGTTCAGGTCGGACGCTTCGCGGGTGAC
GTCGGTGATTTTGTTGACCGGAATGTCGACCGCGCTTCCTTATTCTTTCGGGATAATCTCGCTGGCTATTCCTGG
ATCCCGGAATCGATAAGACCAAATCCTGTCGTGAGGCCGTCAACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCG
CGGCTAGAGCTGGCTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACAGGCCTCATCCTCGTTGTCTGCGGCTCC
GTCGCGTATACGGGCTATCAGAGGAGCCTTCGACGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGAGCGCGCAAT
GGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCCCTAACCAAATCGCTATCCCTCGACCTG
GAAAGGCGAGGCTTCGTCGTCTTCGTCGTCTGTAACGCCGCCGAGGACGAAAACCTGGTACATGCCTTTTCTCGT
CCCGACATCCGGCCTCTCACCATCGACACCACTGACCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGC
TATCTGCAGTCTCCACAGGCCCCCGGCCCCACGGTCAAACCGAACCTGCTGACGCTCAAGTCGGTCATCCTCATC
CCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATACCGCCGTCGAGTTTCGCCGACCTATTCAACACGCAC
CTCCTGCAGCCCATTCTCACCATTCAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTCGGCGAGAAA
TGGATCCCTCCCAAGGTTCTCGTCTTCACGCCTTCCATCATCTCGTCCATCAACCCGCCCTTTCACGCGCCAGAG
GCCACTGTCTGCTCCGCTTTGTCCGCATTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTC
ACCCACGTTCAGCTCGGCACCTTTGACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTACGGTCCGCTCGTGCCG
GCGACGCCCCATGAGACGCTCGTGTGGCCCGACGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAAC
ACGTCGGCCATCTCGGGCGGTCGCATCGGCGGCTTCAAGGGCAGCTCCCTGCGCTGCCTGCACACGACCGTCTTC
GACGTCATCGACGGCTCCATCACCAGCCACTCGGTCCGTGTCGGGCTCGGTGCTGGCATCTATGGCTTTGTCGGC
CGCTGGGCGCCCCGTGGTCTCGTCTCCTGGATGATGGGCATCCGCCGTGTCGATGAGCTGTCAACCTGGAAGGCC
AGTCTGGACGATTCGGCTGGCTGCTCGCCCTGCGGCGAAGACGACGGCGAAGACCCTGCTACGGCGTTGTCGCAC
GAGTTCATCGCCGTCCCGTCGGAGGGCAACGTCTGGAACACGGAAACGGCTGAGAGCAGCCTCTGGGTGCCGTCT
GTGTCTGAGACTTCGTAG
Transcript >Ophun1|6815
ATGTCCGCCGACGATCAGTACTTTCTTGATCAGCTCTCCGGCATCCCCGTTCAGGTCGGACGCTTCGCGGGTGAC
GTCGGTGATTTTGTTGACCGGAATGTCGACCGCGCTTCCTTATTCTTTCGGGATAATCTCGCTGGCTATTCCTGG
ATCCCGGAATCGATAAGACCAAATCCTGTCGTGAGGCCGTCAACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCG
CGGCTAGAGCTGGCTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACAGGCCTCATCCTCGTTGTCTGCGGCTCC
GTCGCGTATACGGGCTATCAGAGGAGCCTTCGACGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGAGCGCGCAAT
GGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCCCTAACCAAATCGCTATCCCTCGACCTG
GAAAGGCGAGGCTTCGTCGTCTTCGTCGTCTGTAACGCCGCCGAGGACGAAAACCTGGTACATGCCTTTTCTCGT
CCCGACATCCGGCCTCTCACCATCGACACCACTGACCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGC
TATCTGCAGTCTCCACAGGCCCCCGGCCCCACGGTCAAACCGAACCTGCTGACGCTCAAGTCGGTCATCCTCATC
CCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATACCGCCGTCGAGTTTCGCCGACCTATTCAACACGCAC
CTCCTGCAGCCCATTCTCACCATTCAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTCGGCGAGAAA
TGGATCCCTCCCAAGGTTCTCGTCTTCACGCCTTCCATCATCTCGTCCATCAACCCGCCCTTTCACGCGCCAGAG
GCCACTGTCTGCTCCGCTTTGTCCGCATTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTC
ACCCACGTTCAGCTCGGCACCTTTGACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTACGGTCCGCTCGTGCCG
GCGACGCCCCATGAGACGCTCGTGTGGCCCGACGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAAC
ACGTCGGCCATCTCGGGCGGTCGCATCGGCGGCTTCAAGGGCAGCTCCCTGCGCTGCCTGCACACGACCGTCTTC
GACGTCATCGACGGCTCCATCACCAGCCACTCGGTCCGTGTCGGGCTCGGTGCTGGCATCTATGGCTTTGTCGGC
CGCTGGGCGCCCCGTGGTCTCGTCTCCTGGATGATGGGCATCCGCCGTGTCGATGAGCTGTCAACCTGGAAGGCC
AGTCTGGACGATTCGGCTGGCTGCTCGCCCTGCGGCGAAGACGACGGCGAAGACCCTGCTACGGCGTTGTCGCAC
GAGTTCATCGCCGTCCCGTCGGAGGGCAACGTCTGGAACACGGAAACGGCTGAGAGCAGCCTCTGGGTGCCGTCT
GTGTCTGAGACTTCGTAG
Gene >Ophun1|6815
ATGTCCGCCGACGATCAGTACTTTCTTGATCAGGTTCGTCGCCCAACACTCACCCCTTGAATCATTTCTCTTGTT
GCTGACTGACCGGGTCCAAGCTCTCCGGCATCCCCGTTCAGGTCGGACGCTTCGCGGGTGACGTCGGTGATTTTG
TTGACCGGAATGTCGACCGCGCTTCCTTATTCTTTCGGGATAATCTCGCTGGCTATTCCTGGATCCCGGAATCGA
TAAGACCAAATCCTGTCGTGAGGCCGTCAACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCGCGGCTAGAGCTGG
CTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACAGGCCTCATCCTCGTTGTCTGCGGCTCCGTCGCGTATACGG
GCTATCAGAGGAGCCTTCGACGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGAGCGCGCAATGGCGGCCGCGTCG
ATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCCCTAACCAAATCGCTATCCCTCGACCTGGAAAGGCGAGGCT
TCGTCGTCTTCGTCGTCTGTAACGCCGCCGAGGACGAAAACCTGGTACATGCCTTTTCTCGTCCCGACATCCGGC
CTCTCACCATCGACACCACTGACGTATGTCCTCCCCCTTTTCCCCCTTCTTCAGGGGCCACACTGATGCTGATCA
TCTTCTCTTCAGCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGCTATCTGCAGTCTCCACAGGCCCCC
GGCCCCACGGTCAAACCGAACCTGCTGACGCTCAAGTCGGTCATCCTCATCCCCAGCCTCCACTACCAGACGTCG
CCCATCGCGACGATACCGCCGTCGAGTTTCGCCGACCTATTCAACACGCACCTCCTGCAGCCCATTCTCACCATT
CAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTCGGCGAGAAATGGATCCCTCCCAAGGTTCTCGTC
TTCACGCCTTCCATCATCTCGTCCATCAACCCGCCCTTTCACGCGCCAGAGGCCACTGTCTGCTCCGCTTTGTCC
GCATTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTCACCCACGTTCAGCTCGGCACCTTT
GACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTACGGTCCGCTCGTGCCGGCGACGCCCCATGAGACGCTCGTG
TGGCCCGACGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAACACGTCGGCCATCTCGGGCGGTCGC
ATCGGCGGCTTCAAGGGCAGCTCCCTGCGCTGCCTGCACACGACCGTCTTCGACGTCATCGACGGCTCCATCACC
AGCCACTCGGTCCGTGTCGGGCTCGGTGCTGGCATCTATGGCTTTGTCGGCCGCTGGGCGCCCCGTGGTCTCGTC
TCCTGGATGATGGGCATCCGCCGTGTCGATGAGCTGTCAACCTGGAAGGCCAGTCTGGACGATTCGGCTGGCTGC
TCGCCCTGCGGCGAAGACGACGGCGAAGACCCTGCTACGGCGTTGTCGCACGAGTTCATCGCCGTCCCGTCGGAG
GGCAACGTCTGGAACACGGAAACGGCTGAGAGCAGCCTCTGGGTGCCGTCTGTGTCTGAGACTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail