Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6809
Gene name
LocationContig_78:14740..16155
Strand+
Gene length (bp)1415
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.3E-31 44 411
PF00083 Sugar_tr Sugar (and other) transporter 1.4E-12 77 230
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.6E-07 38 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 28 410 5.0E-32
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 14 411 9.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 14 411 1.0E-28
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 35 411 3.0E-27
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 30 396 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 28 410 5.0E-32
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 14 411 9.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 14 411 1.0E-28
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 35 411 3.0E-27
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 30 396 3.0E-23
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 16 411 1.0E-20
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 19 408 8.0E-20
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 17 408 3.0E-18
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 24 408 5.0E-18
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 6 413 7.0E-18
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 30 408 1.0E-17
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 4 408 5.0E-17
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 16 410 2.0E-16
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 16 413 2.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 1 245 2.0E-16
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 15 408 3.0E-16
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 32 408 4.0E-16
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 28 413 1.0E-15
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 28 413 1.0E-15
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 15 413 2.0E-15
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 28 413 1.0E-14
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 57 393 1.0E-13
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 23 395 1.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 4 403 3.0E-12
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 47 413 3.0E-12
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 75 408 4.0E-12
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 10 221 8.0E-11
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 83 359 3.0E-10
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 16 411 5.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 13 411 7.0E-09
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 32 403 3.0E-08
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 317 411 5.0E-08
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 83 409 8.0E-08
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 88 403 6.0E-07
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 89 231 8.0E-07
sp|P76628|YGAY_ECOLI Putative uncharacterized transporter YgaY OS=Escherichia coli (strain K12) GN=ygaY PE=5 SV=2 77 218 9.0E-07
sp|Q8X4V6|YGAY_ECO57 Uncharacterized transporter YgaY OS=Escherichia coli O157:H7 GN=ygaY PE=3 SV=1 77 218 9.0E-07
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 78 231 2.0E-06
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 98 234 8.0E-06
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 98 234 8.0E-06
sp|Q88K63|SOTB_PSEPK Probable sugar efflux transporter OS=Pseudomonas putida (strain KT2440) GN=sotB PE=3 SV=2 44 214 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 109 126 17
3 133 155 22
4 197 216 19
5 252 274 22
6 294 316 22
7 336 358 22
8 368 390 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6809
MPGSERRPLLAPEAVSHHPEPPISASTNLLAWPKAQKWRIMTLLAFMSFNVTFVCISVVPVASRIVHDIGSGSHA
RSTSVLLVTGWELGEAIGPFFIGPLSETWGRRPVIHAMNTIFVLTIVLSALSQTTTLLIAARIAAGMVVSTNVLS
PAIAGDIMLPGERGSALALTATANLAGGAIGSAVGGLVAEGLGWRSVLWLGTALASLSTLLLIIYFPETYRPSLT
RGNQDEHFKQDGSGTVVGSIARPAHMLWSSSILVVISLFHGLGFSIYYIMSVTMPDIVENIFNGSPATTGLYLIS
FSVGSAISMLLCHFFLDNIYLRLSKRTPHQAKPEYWLPLAIIGSLMMPASTLLYGWTAQAHLPKPLLLCALSFIG
TSLLLSMLPVFAYVVDAFGKYSASAMAAVMMTRCLMVS*
Coding >Ophun1|6809
ATGCCGGGCTCCGAACGCCGGCCTCTGCTCGCCCCGGAAGCAGTCTCTCACCATCCGGAACCCCCAATTTCTGCT
TCAACCAACCTCCTCGCCTGGCCCAAAGCCCAAAAATGGAGAATCATGACTCTCCTCGCCTTCATGTCCTTCAAC
GTCACATTCGTCTGCATCTCCGTCGTCCCCGTGGCATCCCGCATCGTCCATGATATCGGCTCAGGCTCCCACGCT
CGCTCAACCAGCGTCCTCCTCGTAACAGGCTGGGAACTAGGCGAAGCAATCGGCCCCTTCTTCATCGGCCCACTC
TCCGAAACATGGGGCCGCCGACCCGTCATCCACGCCATGAATACAATCTTCGTCCTGACCATTGTCCTCAGCGCG
CTTTCGCAAACAACGACGCTGCTCATCGCCGCCAGGATCGCCGCTGGGATGGTTGTTAGTACAAACGTGCTGAGC
CCGGCTATTGCTGGCGACATCATGCTTCCCGGTGAGCGGGGGAGTGCCTTGGCCCTGACTGCTACGGCCAACCTC
GCTGGCGGGGCCATCGGCTCCGCTGTTGGTGGTCTCGTTGCCGAGGGACTTGGCTGGCGATCCGTTCTCTGGCTT
GGAACCGCTCTGGCTTCGCTGAGCACCCTGCTGCTCATCATCTACTTCCCCGAAACATACCGTCCATCTCTCACG
AGAGGAAACCAGGACGAACACTTCAAGCAGGATGGAAGCGGCACCGTCGTCGGATCCATTGCCCGACCGGCGCAC
ATGCTATGGTCCTCCAGCATCCTAGTCGTCATATCGCTATTCCACGGACTGGGCTTCTCCATCTACTACATCATG
TCCGTGACCATGCCCGACATTGTCGAGAATATCTTCAACGGCTCTCCCGCCACAACAGGGCTCTACCTCATAAGT
TTCTCGGTAGGATCAGCCATCAGCATGCTCCTCTGCCACTTCTTCCTCGACAACATCTACCTCCGCCTCAGCAAA
CGCACCCCCCACCAGGCCAAGCCCGAATACTGGCTCCCCCTCGCCATCATCGGCTCACTGATGATGCCCGCCTCA
ACCCTCCTCTACGGATGGACAGCCCAAGCCCACCTCCCCAAACCGCTCCTCCTATGCGCCCTGTCCTTCATCGGA
ACCTCGCTTCTGCTGTCGATGCTCCCCGTCTTCGCCTACGTCGTCGACGCGTTCGGTAAATATTCCGCCTCTGCC
ATGGCCGCCGTCATGATGACGAGGTGTTTGATGGTGTCTTGA
Transcript >Ophun1|6809
ATGCCGGGCTCCGAACGCCGGCCTCTGCTCGCCCCGGAAGCAGTCTCTCACCATCCGGAACCCCCAATTTCTGCT
TCAACCAACCTCCTCGCCTGGCCCAAAGCCCAAAAATGGAGAATCATGACTCTCCTCGCCTTCATGTCCTTCAAC
GTCACATTCGTCTGCATCTCCGTCGTCCCCGTGGCATCCCGCATCGTCCATGATATCGGCTCAGGCTCCCACGCT
CGCTCAACCAGCGTCCTCCTCGTAACAGGCTGGGAACTAGGCGAAGCAATCGGCCCCTTCTTCATCGGCCCACTC
TCCGAAACATGGGGCCGCCGACCCGTCATCCACGCCATGAATACAATCTTCGTCCTGACCATTGTCCTCAGCGCG
CTTTCGCAAACAACGACGCTGCTCATCGCCGCCAGGATCGCCGCTGGGATGGTTGTTAGTACAAACGTGCTGAGC
CCGGCTATTGCTGGCGACATCATGCTTCCCGGTGAGCGGGGGAGTGCCTTGGCCCTGACTGCTACGGCCAACCTC
GCTGGCGGGGCCATCGGCTCCGCTGTTGGTGGTCTCGTTGCCGAGGGACTTGGCTGGCGATCCGTTCTCTGGCTT
GGAACCGCTCTGGCTTCGCTGAGCACCCTGCTGCTCATCATCTACTTCCCCGAAACATACCGTCCATCTCTCACG
AGAGGAAACCAGGACGAACACTTCAAGCAGGATGGAAGCGGCACCGTCGTCGGATCCATTGCCCGACCGGCGCAC
ATGCTATGGTCCTCCAGCATCCTAGTCGTCATATCGCTATTCCACGGACTGGGCTTCTCCATCTACTACATCATG
TCCGTGACCATGCCCGACATTGTCGAGAATATCTTCAACGGCTCTCCCGCCACAACAGGGCTCTACCTCATAAGT
TTCTCGGTAGGATCAGCCATCAGCATGCTCCTCTGCCACTTCTTCCTCGACAACATCTACCTCCGCCTCAGCAAA
CGCACCCCCCACCAGGCCAAGCCCGAATACTGGCTCCCCCTCGCCATCATCGGCTCACTGATGATGCCCGCCTCA
ACCCTCCTCTACGGATGGACAGCCCAAGCCCACCTCCCCAAACCGCTCCTCCTATGCGCCCTGTCCTTCATCGGA
ACCTCGCTTCTGCTGTCGATGCTCCCCGTCTTCGCCTACGTCGTCGACGCGTTCGGTAAATATTCCGCCTCTGCC
ATGGCCGCCGTCATGATGACGAGGTGTTTGATGGTGTCTTGA
Gene >Ophun1|6809
ATGCCGGGCTCCGAACGCCGGCCTCTGCTCGCCCCGGAAGCAGTCTCTCACCATCCGGAACCCCCAATTTCTGCT
TCAACCAACCTCCTCGCCTGGCCCAAAGCCCAAAAATGGAGAATCATGACTCTCCTCGCCTTCATGTCCTTCAAC
GTGTTCGTCCCTCAACCCACAATCTTCACCCAATTCATCCTTCTAATCGGCACAGCACATTCGTCTGCATCTCCG
TCGTCCCCGTGGCATCCCGCATCGTCCATGATATCGGCTCAGGCTCCCACGCTCGCTCAACCAGCGTCCTCCTCG
TAACAGGCTGGGAACTAGGCGAAGCAATCGGCCCCTTCTTCATCGGCCCACTCTCCGAAACATGGGGCCGCCGAC
CCGTCATCCACGCCATGAATACAATCTTCGTCCTGACCATTGTCCTCAGCGCGCTTTCGCAAACAACGACGCTGC
TCATCGCCGCCAGGATCGCCGCTGGGATGGTTGTTAGTACAAACGTGCTGAGCCCGGCTATTGCTGGCGACATCA
TGCTTCCCGGTGAGCGGGGGAGTGCCTTGGCCCTGACTGCTACGGCCAACCTCGCTGGCGGGGCCATCGGCTCCG
CTGTTGGTGGTCTCGTTGCCGAGGGACTTGGCTGGCGATCCGTTCTCTGGCTTGGAACCGCTCTGGCTTCGCTGA
GCACCCTGCTGCTCATCATCTACTTCCCCGAAACATACCGTCCATCTCTCACGAGAGGAAACCAGGACGAACACT
TCAAGCAGGATGGAAGCGGCACCGTCGTCGGATCCATTGCCCGACCGGCGCACATGCTATGGTCCTCCAGCATCC
TAGTCGTCATATCGCTATTCCACGGACTGGGCTTCTCCATCTACTACATCATGTCCGTGACCATGCCCGACATTG
TCGAGAATATCTTCAACGGCTCTCCCGCCACAACAGGGCTCTACCTCATAAGTTTCTGTACGCAACGCACCTCAC
CCTCCCCAACGCCCTACTCTAACCCAACCGAAAACCAGCGGTAGGATCAGCCATCAGCATGCTCCTCTGCCACTT
CTTCCTCGACAACATCTACCTCCGCCTCAGCAAACGCACCCCCCACCAGGCCAAGCCCGAATACTGGCTCCCCCT
CGCCATCATCGGCTCACTGATGATGCCCGCCTCAACCCTCCTCTACGGATGGACAGCCCAAGCCCACCTCCCCAA
ACCGCTCCTCCTATGCGCCCTGTCCTTCATCGGAACCTCGCTTCTGCTGTCGATGCTCCCCGTCTTCGCCTACGT
CGTCGACGCGTTCGGTAAATATTCCGCCTCTGCCATGGCCGCCGTCATGATGACGAGGTGTTTGATGGGTGCGCT
GGTTCCGCTGGCCATATGGCCGCTGGTTGAGAGCCTTGGCTATGGATGGGGATTTAGTGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail