Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6798
Gene name
LocationContig_778:4709..7102
Strand+
Gene length (bp)2393
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13522 GATase_6 Glutamine amidotransferase domain 1.7E-13 72 200
PF13537 GATase_7 Glutamine amidotransferase domain 2.0E-10 85 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41390|PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 1 510 0.0E+00
sp|Q12698|PUR1_LACKL Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 1 500 2.0E-179
sp|P04046|PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 1 495 1.0E-178
sp|Q9L6B8|PUR1_PASMU Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 1 514 3.0E-157
sp|Q51342|PUR1_PSEAE Amidophosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purF PE=3 SV=3 1 502 7.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41390|PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 1 510 0.0E+00
sp|Q12698|PUR1_LACKL Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 1 500 2.0E-179
sp|P04046|PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 1 495 1.0E-178
sp|Q9L6B8|PUR1_PASMU Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 1 514 3.0E-157
sp|Q51342|PUR1_PSEAE Amidophosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purF PE=3 SV=3 1 502 7.0E-156
sp|P0AG17|PUR1_SHIFL Amidophosphoribosyltransferase OS=Shigella flexneri GN=purF PE=3 SV=2 1 499 3.0E-149
sp|P0AG16|PUR1_ECOLI Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) GN=purF PE=1 SV=2 1 499 3.0E-149
sp|P43854|PUR1_HAEIN Amidophosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purF PE=3 SV=2 1 501 1.0E-147
sp|Q57657|PUR1_METJA Amidophosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purF PE=3 SV=3 1 482 1.0E-82
sp|O29388|PUR1_ARCFU Amidophosphoribosyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purF PE=3 SV=3 1 483 2.0E-81
sp|Q55038|PUR1_SYNE7 Amidophosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=purF PE=3 SV=1 2 484 2.0E-81
sp|O57979|PUR1_PYRHO Amidophosphoribosyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purF PE=3 SV=1 2 455 2.0E-72
sp|P00497|PUR1_BACSU Amidophosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=purF PE=1 SV=2 24 482 5.0E-72
sp|Q55621|PUR1_SYNY3 Amidophosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purF PE=3 SV=1 25 484 3.0E-71
sp|O26742|PUR1_METTH Amidophosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purF PE=3 SV=1 2 489 1.0E-70
sp|P9WHQ7|PUR1_MYCTU Amidophosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purF PE=1 SV=1 25 483 7.0E-69
sp|P9WHQ6|PUR1_MYCTO Amidophosphoribosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purF PE=3 SV=1 25 483 7.0E-69
sp|P65830|PUR1_MYCBO Amidophosphoribosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purF PE=3 SV=1 25 483 7.0E-69
sp|Q9V253|PUR1_PYRAB Amidophosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purF PE=3 SV=1 2 455 3.0E-68
sp|Q50028|PUR1_MYCLE Amidophosphoribosyltransferase OS=Mycobacterium leprae (strain TN) GN=purF PE=3 SV=1 25 507 2.0E-67
sp|Q5HQA0|PUR1_STAEQ Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purF PE=3 SV=1 2 463 1.0E-66
sp|Q8CT30|PUR1_STAES Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purF PE=3 SV=1 2 463 1.0E-66
sp|Q8NX91|PUR1_STAAW Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|Q6GAE3|PUR1_STAAS Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|Q5HH14|PUR1_STAAC Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|P99164|PUR1_STAAN Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=purF PE=1 SV=1 2 526 2.0E-64
sp|P65831|PUR1_STAAM Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purF PE=3 SV=1 2 526 2.0E-64
sp|Q9STG9|ASE2_ARATH Amidophosphoribosyltransferase 2, chloroplastic OS=Arabidopsis thaliana GN=ASE2 PE=1 SV=1 2 484 3.0E-64
sp|Q9SI61|ASE1_ARATH Amidophosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=ASE1 PE=2 SV=1 2 473 1.0E-63
sp|Q86A85|PUR1_DICDI Amidophosphoribosyltransferase OS=Dictyostelium discoideum GN=purF PE=3 SV=1 2 455 1.0E-63
sp|Q6GI14|PUR1_STAAR Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purF PE=3 SV=1 2 463 2.0E-63
sp|P52418|PUR1_SOYBN Amidophosphoribosyltransferase, chloroplastic OS=Glycine max GN=PUR1 PE=2 SV=1 2 509 1.0E-62
sp|Q9T0J5|ASE3_ARATH Amidophosphoribosyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=ASE3 PE=1 SV=1 2 485 6.0E-61
sp|P52419|PUR1_VIGAC Amidophosphoribosyltransferase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PUR1 PE=2 SV=1 2 453 2.0E-58
sp|P77935|PUR1_RHIEC Amidophosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purF PE=3 SV=2 2 482 9.0E-57
sp|P35433|PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus GN=Ppat PE=1 SV=1 2 452 1.0E-56
sp|P28173|PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus GN=PPAT PE=2 SV=1 25 465 5.0E-56
sp|Q27601|PUR1_DROME Amidophosphoribosyltransferase OS=Drosophila melanogaster GN=Prat PE=1 SV=2 25 484 5.0E-56
sp|Q06203|PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens GN=PPAT PE=1 SV=1 2 452 1.0E-54
sp|Q8CY30|GLMS_BRUSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 1 232 1.0E-14
sp|Q8YC47|GLMS_BRUME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 1 232 1.0E-14
sp|Q577Y1|GLMS_BRUAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 1 232 1.0E-14
sp|P35853|PUR1_LACCA Amidophosphoribosyltransferase (Fragment) OS=Lactobacillus casei GN=purF PE=3 SV=2 2 198 2.0E-12
sp|O57981|GLMS_PYRHO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glmS PE=3 SV=3 1 179 2.0E-11
sp|Q9V249|GLMS_PYRAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glmS PE=3 SV=3 1 179 3.0E-11
sp|Q6G322|GLMS_BARHE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmS PE=3 SV=3 1 220 8.0E-11
sp|Q5FUY5|GLMS_GLUOX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 1 250 8.0E-10
sp|Q4J6D9|GLMS_SULAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glmS PE=3 SV=3 1 245 1.0E-09
sp|O26273|GLMS_METTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glmS PE=3 SV=3 1 220 1.0E-09
sp|P59362|GLMS_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glmS PE=3 SV=2 1 293 3.0E-09
sp|Q7W334|GLMS_BORPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmS PE=3 SV=3 1 260 3.0E-09
sp|Q7WE36|GLMS_BORBR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmS PE=3 SV=3 1 260 3.0E-09
sp|Q7VRZ3|GLMS_BORPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmS PE=3 SV=3 1 260 4.0E-09
sp|Q5NRH4|GLMS_ZYMMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmS PE=3 SV=3 1 229 2.0E-08
sp|Q9HT00|GLMS_HALSA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glmS PE=3 SV=3 1 259 2.0E-08
sp|Q9HT25|GLMS_PSEAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glmS PE=3 SV=3 1 231 2.0E-08
sp|Q8TZ14|GLMS_METKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glmS PE=3 SV=3 1 198 6.0E-08
sp|O26060|GLMS_HELPY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glmS PE=3 SV=3 1 177 6.0E-08
sp|Q8NND3|GLMS_CORGL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmS PE=3 SV=2 1 177 6.0E-08
sp|Q9ZJ94|GLMS_HELPJ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glmS PE=3 SV=3 1 177 8.0E-08
sp|Q8XHZ7|GLMS_CLOPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 1 139 1.0E-07
sp|Q5JH71|GLMS_THEKO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glmS PE=3 SV=3 1 198 2.0E-07
sp|O84823|GLMS_CHLTR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmS PE=3 SV=3 1 177 2.0E-07
sp|Q88BX8|GLMS_PSEPK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 1 252 2.0E-07
sp|Q56213|GLMS_THET8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 1 175 3.0E-07
sp|Q72HF4|GLMS_THET2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 1 175 3.0E-07
sp|O68280|GLMS_NOSS9 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Nostoc sp. (strain PCC 9229) GN=glmS PE=3 SV=3 1 181 6.0E-07
sp|Q74GH6|GLMS_GEOSL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 1 245 1.0E-06
sp|Q5XBV6|GLMS_STRP6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 1 198 1.0E-06
sp|Q97SQ9|GLMS_STRPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmS PE=3 SV=3 1 173 2.0E-06
sp|P94323|NODM_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 1 223 2.0E-06
sp|Q83FU2|GLMS_TROWT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain Twist) GN=glmS PE=3 SV=3 1 177 3.0E-06
sp|Q83IA1|GLMS_TROW8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain TW08/27) GN=glmS PE=3 SV=3 1 177 3.0E-06
sp|Q8DRA8|GLMS_STRR6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 1 173 3.0E-06
sp|P08633|NODM_RHILV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 1 220 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6798
MCGVTALLLGDSKATTAAVDLHEALYFLQHRGQDAAGITVCQGGRLYQCKGNGMAAKVFAEGKRVADLPGFAGIS
HLRYPTAGTSSASEAQPFYVNSPFGLSMSVNGNLVNNAELRNFLDLEARRHVNTHSDSELLLNIFAHALNELGKA
RANVDDVFTALRDVYARCRGAFACTAMIAGFGILGFRDENGIRPLCLGSRPSATLDGATDYMMASESIALTQLGF
GDIVDILPGQAVFIEKGGAPRFRQIVERKSYTPDIFEYVYFARPDSCIDGISVHRSRQKMGLRLAKKIKDTLGEK
GVAEIDVVIPVPETSNTAAAVLASYLNKPFSNAFVKNRYVYRTFILPGQTTRQKSVRRKLSPIHSEFRGKAVCLV
DDSIVRGTTSREIVQMARDAGAVRVLFASCSPGVTHPHVYGIDLADPAELIAHKKTRHEIATHIDADDVIYQDLE
DLQEACVEAAEGDSEVKEFEIGVFCGEYKTEVPEGYFEHLSRLRERGKKRKNGDVDEADASTKKASLLADSGPLN
VTSEPQKSNGAGGEETVGVKHRGDISLHNFADER*
Coding >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGCTGGGCGATTCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTC
TACTTCCTCCAACATCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTATCAGTGCAAG
GGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGCTGGCATCAGC
CATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGA
TTGTCGATGAGCGTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGA
CATGTCAACACGCACTCTGACTCGGAGCTCTTACTCAACATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCC
CGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGATGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACG
GCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGAGACGAGAATGGCATCCGGCCCCTCTGCCTGGGATCCCGG
CCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCACCCAGCTCGGCTTC
GGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGCGGTTTCGCCAGATT
GTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACAGCTGCATCGACGGC
ATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACACTCTTGGGGAGAAG
GGGGTTGCTGAGATTGATGTTGTGATACCGGTTCCGGAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTAC
CTCAACAAGCCGTTTTCGAATGCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACG
ACACGACAGAAAAGCGTCCGTCGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTC
GATGATTCGATAGTGCGAGGAACCACGTCGCGTGAGATAGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTG
CTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCCTCATGTTTACGGCATAGATCTGGCAGATCCAGCGGAGTTG
ATTGCACACAAAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAA
GATCTTCAAGAAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGC
GGAGAGTACAAAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGG
AAGAATGGAGACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAAC
GTGACGTCGGAGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATC
AGCCTCCACAACTTTGCAGACGAGCGCTGA
Transcript >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGCTGGGCGATTCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTC
TACTTCCTCCAACATCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTATCAGTGCAAG
GGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGCTGGCATCAGC
CATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGA
TTGTCGATGAGCGTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGA
CATGTCAACACGCACTCTGACTCGGAGCTCTTACTCAACATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCC
CGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGATGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACG
GCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGAGACGAGAATGGCATCCGGCCCCTCTGCCTGGGATCCCGG
CCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCACCCAGCTCGGCTTC
GGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGCGGTTTCGCCAGATT
GTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACAGCTGCATCGACGGC
ATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACACTCTTGGGGAGAAG
GGGGTTGCTGAGATTGATGTTGTGATACCGGTTCCGGAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTAC
CTCAACAAGCCGTTTTCGAATGCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACG
ACACGACAGAAAAGCGTCCGTCGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTC
GATGATTCGATAGTGCGAGGAACCACGTCGCGTGAGATAGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTG
CTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCCTCATGTTTACGGCATAGATCTGGCAGATCCAGCGGAGTTG
ATTGCACACAAAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAA
GATCTTCAAGAAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGC
GGAGAGTACAAAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGG
AAGAATGGAGACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAAC
GTGACGTCGGAGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATC
AGCCTCCACAACTTTGCAGACGAGCGCTGA
Gene >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGGTCAGTCTCTCTCCCTGTTCTTGGCCCTGGTCGAAGCTGTGGTCTGAGGCC
TCTTTTCCTGCGCATCTTCCGATGGCTCTGTGAGTCGGCTGGGTTTGGGCTGACTTGTCTTGTCAGCTGGGCGAT
TCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTCTACTTCCTCCAACATGTAAGTGTCTACGTTCTC
ACGGTCCGGATCGAGGATGAAGCCTCTCCGACGCCCCTAAAACCCCCCCAAACTCCTACTCACTGGCGTATTCTT
GCCTTGATGCTGACGCCTGAAATAGCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTA
TCAGTGCAAGGGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGC
TGGCATCAGCCATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTGCGCTCATCCCGGAGACGGAGCTTTCGG
GACTCGGCTGATGACTCTCTCAGGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGATTGTCGATGAGC
GTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGACATGTCAACACG
CACTCTGACTCGGAGCTCTTGTAAGTCGATCTGTCATCTCTTCTCCTCGCTTTCATCTCACCCTCTCAGACTCAA
CATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCCCGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGA
TGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACGGCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGGTG
AGTCGTCTGGCCTGCGTCTTGGCAATGGCAACTAAGGCGTCGCATCCAGAGACGAGAATGGCATCCGGCCCCTCT
GCCTGGGATCCCGGCCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCA
CCCAGCTCGGCTTCGGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGC
GGTTTCGCCAGATTGTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACA
GCTGCATCGACGGCATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACA
CTCTTGGGGAGAAGGGGGTTGCTGAGATTGATGTTGGTATGCAAGCCGGCAGTCCTTACAGCGCGAGAATTGGTC
AAGATGCTGACCAGCCGTTGAAAAGTGATACCGGTTCCGGAGGTAAAGTGTTTGAGTCGCTCTCGACGTCACACG
CTCACAGATCTCGTCTAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTACCTCAACAAGCCGTTTTCGAAT
GCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACGACACGACAGAAAAGCGTCCGT
CGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTCGATGATTCGATAGTGCGAGGA
ACCACGTCGCGTGAGATAGTAAGTGGCCGCTACCTAGTGGCATCTCGACCCGAAGAGGTCATGCTGACTATTGGC
TCAGGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTGCTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCC
TCATGTTGTAAGTGAGAGCAGTCTCATCACGTACGGTGCTGACCACGTGGCAGTACGGCATAGATCTGGCAGATC
CAGCGGGTATGAAAGACAACGGAATGGCTCTGCCGGGGAAGAGGCTGACTGAGAATGCAGAGTTGATTGCACACA
AAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAAGATCTTCAAG
AAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGCGGAGAGTACA
AAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGGAAGAATGGAG
ACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAACGTGACGTCGG
AGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATCAGGTAAGTCT
CTCATGTTGATGTGCGAATGGCGAACTAACAGCAGCGCAGCCTCCACAACTTTGCAGACGAGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail