Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6798
Gene name
LocationContig_778:4709..7102
Strand+
Gene length (bp)2393
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13522 GATase_6 Glutamine amidotransferase domain 1.7E-13 72 200
PF13537 GATase_7 Glutamine amidotransferase domain 2.0E-10 85 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41390|PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 1 510 0.0E+00
sp|Q12698|PUR1_LACKL Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 1 500 2.0E-179
sp|P04046|PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 1 495 1.0E-178
sp|Q9L6B8|PUR1_PASMU Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 1 514 3.0E-157
sp|Q51342|PUR1_PSEAE Amidophosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purF PE=3 SV=3 1 502 7.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41390|PUR1_SCHPO Amidophosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade4 PE=1 SV=1 1 510 0.0E+00
sp|Q12698|PUR1_LACKL Amidophosphoribosyltransferase OS=Lachancea kluyveri GN=ADE4 PE=3 SV=1 1 500 2.0E-179
sp|P04046|PUR1_YEAST Amidophosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE4 PE=1 SV=2 1 495 1.0E-178
sp|Q9L6B8|PUR1_PASMU Amidophosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=purF PE=3 SV=3 1 514 3.0E-157
sp|Q51342|PUR1_PSEAE Amidophosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purF PE=3 SV=3 1 502 7.0E-156
sp|P0AG17|PUR1_SHIFL Amidophosphoribosyltransferase OS=Shigella flexneri GN=purF PE=3 SV=2 1 499 3.0E-149
sp|P0AG16|PUR1_ECOLI Amidophosphoribosyltransferase OS=Escherichia coli (strain K12) GN=purF PE=1 SV=2 1 499 3.0E-149
sp|P43854|PUR1_HAEIN Amidophosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purF PE=3 SV=2 1 501 1.0E-147
sp|Q57657|PUR1_METJA Amidophosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purF PE=3 SV=3 1 482 1.0E-82
sp|O29388|PUR1_ARCFU Amidophosphoribosyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purF PE=3 SV=3 1 483 2.0E-81
sp|Q55038|PUR1_SYNE7 Amidophosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=purF PE=3 SV=1 2 484 2.0E-81
sp|O57979|PUR1_PYRHO Amidophosphoribosyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purF PE=3 SV=1 2 455 2.0E-72
sp|P00497|PUR1_BACSU Amidophosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=purF PE=1 SV=2 24 482 5.0E-72
sp|Q55621|PUR1_SYNY3 Amidophosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purF PE=3 SV=1 25 484 3.0E-71
sp|O26742|PUR1_METTH Amidophosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purF PE=3 SV=1 2 489 1.0E-70
sp|P9WHQ7|PUR1_MYCTU Amidophosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purF PE=1 SV=1 25 483 7.0E-69
sp|P9WHQ6|PUR1_MYCTO Amidophosphoribosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purF PE=3 SV=1 25 483 7.0E-69
sp|P65830|PUR1_MYCBO Amidophosphoribosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purF PE=3 SV=1 25 483 7.0E-69
sp|Q9V253|PUR1_PYRAB Amidophosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purF PE=3 SV=1 2 455 3.0E-68
sp|Q50028|PUR1_MYCLE Amidophosphoribosyltransferase OS=Mycobacterium leprae (strain TN) GN=purF PE=3 SV=1 25 507 2.0E-67
sp|Q5HQA0|PUR1_STAEQ Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purF PE=3 SV=1 2 463 1.0E-66
sp|Q8CT30|PUR1_STAES Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purF PE=3 SV=1 2 463 1.0E-66
sp|Q8NX91|PUR1_STAAW Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|Q6GAE3|PUR1_STAAS Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|Q5HH14|PUR1_STAAC Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=purF PE=3 SV=1 2 526 1.0E-64
sp|P99164|PUR1_STAAN Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=purF PE=1 SV=1 2 526 2.0E-64
sp|P65831|PUR1_STAAM Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purF PE=3 SV=1 2 526 2.0E-64
sp|Q9STG9|ASE2_ARATH Amidophosphoribosyltransferase 2, chloroplastic OS=Arabidopsis thaliana GN=ASE2 PE=1 SV=1 2 484 3.0E-64
sp|Q9SI61|ASE1_ARATH Amidophosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=ASE1 PE=2 SV=1 2 473 1.0E-63
sp|Q86A85|PUR1_DICDI Amidophosphoribosyltransferase OS=Dictyostelium discoideum GN=purF PE=3 SV=1 2 455 1.0E-63
sp|Q6GI14|PUR1_STAAR Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purF PE=3 SV=1 2 463 2.0E-63
sp|P52418|PUR1_SOYBN Amidophosphoribosyltransferase, chloroplastic OS=Glycine max GN=PUR1 PE=2 SV=1 2 509 1.0E-62
sp|Q9T0J5|ASE3_ARATH Amidophosphoribosyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=ASE3 PE=1 SV=1 2 485 6.0E-61
sp|P52419|PUR1_VIGAC Amidophosphoribosyltransferase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PUR1 PE=2 SV=1 2 453 2.0E-58
sp|P77935|PUR1_RHIEC Amidophosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purF PE=3 SV=2 2 482 9.0E-57
sp|P35433|PUR1_RAT Amidophosphoribosyltransferase OS=Rattus norvegicus GN=Ppat PE=1 SV=1 2 452 1.0E-56
sp|P28173|PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus GN=PPAT PE=2 SV=1 25 465 5.0E-56
sp|Q27601|PUR1_DROME Amidophosphoribosyltransferase OS=Drosophila melanogaster GN=Prat PE=1 SV=2 25 484 5.0E-56
sp|Q06203|PUR1_HUMAN Amidophosphoribosyltransferase OS=Homo sapiens GN=PPAT PE=1 SV=1 2 452 1.0E-54
sp|Q8CY30|GLMS_BRUSU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 1 232 1.0E-14
sp|Q8YC47|GLMS_BRUME Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 1 232 1.0E-14
sp|Q577Y1|GLMS_BRUAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 1 232 1.0E-14
sp|P35853|PUR1_LACCA Amidophosphoribosyltransferase (Fragment) OS=Lactobacillus casei GN=purF PE=3 SV=2 2 198 2.0E-12
sp|O57981|GLMS_PYRHO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glmS PE=3 SV=3 1 179 2.0E-11
sp|Q9V249|GLMS_PYRAB Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glmS PE=3 SV=3 1 179 3.0E-11
sp|Q6G322|GLMS_BARHE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmS PE=3 SV=3 1 220 8.0E-11
sp|Q5FUY5|GLMS_GLUOX Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 1 250 8.0E-10
sp|Q4J6D9|GLMS_SULAC Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glmS PE=3 SV=3 1 245 1.0E-09
sp|O26273|GLMS_METTH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glmS PE=3 SV=3 1 220 1.0E-09
sp|P59362|GLMS_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glmS PE=3 SV=2 1 293 3.0E-09
sp|Q7W334|GLMS_BORPA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmS PE=3 SV=3 1 260 3.0E-09
sp|Q7WE36|GLMS_BORBR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmS PE=3 SV=3 1 260 3.0E-09
sp|Q7VRZ3|GLMS_BORPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmS PE=3 SV=3 1 260 4.0E-09
sp|Q5NRH4|GLMS_ZYMMO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmS PE=3 SV=3 1 229 2.0E-08
sp|Q9HT00|GLMS_HALSA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glmS PE=3 SV=3 1 259 2.0E-08
sp|Q9HT25|GLMS_PSEAE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glmS PE=3 SV=3 1 231 2.0E-08
sp|Q8TZ14|GLMS_METKA Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glmS PE=3 SV=3 1 198 6.0E-08
sp|O26060|GLMS_HELPY Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glmS PE=3 SV=3 1 177 6.0E-08
sp|Q8NND3|GLMS_CORGL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmS PE=3 SV=2 1 177 6.0E-08
sp|Q9ZJ94|GLMS_HELPJ Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glmS PE=3 SV=3 1 177 8.0E-08
sp|Q8XHZ7|GLMS_CLOPE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 1 139 1.0E-07
sp|Q5JH71|GLMS_THEKO Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glmS PE=3 SV=3 1 198 2.0E-07
sp|O84823|GLMS_CHLTR Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmS PE=3 SV=3 1 177 2.0E-07
sp|Q88BX8|GLMS_PSEPK Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 1 252 2.0E-07
sp|Q56213|GLMS_THET8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 1 175 3.0E-07
sp|Q72HF4|GLMS_THET2 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 1 175 3.0E-07
sp|O68280|GLMS_NOSS9 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Nostoc sp. (strain PCC 9229) GN=glmS PE=3 SV=3 1 181 6.0E-07
sp|Q74GH6|GLMS_GEOSL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 1 245 1.0E-06
sp|Q5XBV6|GLMS_STRP6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 1 198 1.0E-06
sp|Q97SQ9|GLMS_STRPN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmS PE=3 SV=3 1 173 2.0E-06
sp|P94323|NODM_BRADU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 1 223 2.0E-06
sp|Q83FU2|GLMS_TROWT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain Twist) GN=glmS PE=3 SV=3 1 177 3.0E-06
sp|Q83IA1|GLMS_TROW8 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain TW08/27) GN=glmS PE=3 SV=3 1 177 3.0E-06
sp|Q8DRA8|GLMS_STRR6 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 1 173 3.0E-06
sp|P08633|NODM_RHILV Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 1 220 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup629
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5183
Ophiocordyceps australis map64 (Brazil) OphauB2|2363
Ophiocordyceps camponoti-floridani Ophcf2|05256
Ophiocordyceps camponoti-rufipedis Ophun1|6798 (this protein)
Ophiocordyceps kimflemingae Ophio5|1969
Ophiocordyceps subramaniannii Hirsu2|10162
Ophiocordyceps subramaniannii Hirsu2|231

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6798
MCGVTALLLGDSKATTAAVDLHEALYFLQHRGQDAAGITVCQGGRLYQCKGNGMAAKVFAEGKRVADLPGFAGIS
HLRYPTAGTSSASEAQPFYVNSPFGLSMSVNGNLVNNAELRNFLDLEARRHVNTHSDSELLLNIFAHALNELGKA
RANVDDVFTALRDVYARCRGAFACTAMIAGFGILGFRDENGIRPLCLGSRPSATLDGATDYMMASESIALTQLGF
GDIVDILPGQAVFIEKGGAPRFRQIVERKSYTPDIFEYVYFARPDSCIDGISVHRSRQKMGLRLAKKIKDTLGEK
GVAEIDVVIPVPETSNTAAAVLASYLNKPFSNAFVKNRYVYRTFILPGQTTRQKSVRRKLSPIHSEFRGKAVCLV
DDSIVRGTTSREIVQMARDAGAVRVLFASCSPGVTHPHVYGIDLADPAELIAHKKTRHEIATHIDADDVIYQDLE
DLQEACVEAAEGDSEVKEFEIGVFCGEYKTEVPEGYFEHLSRLRERGKKRKNGDVDEADASTKKASLLADSGPLN
VTSEPQKSNGAGGEETVGVKHRGDISLHNFADER*
Coding >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGCTGGGCGATTCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTC
TACTTCCTCCAACATCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTATCAGTGCAAG
GGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGCTGGCATCAGC
CATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGA
TTGTCGATGAGCGTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGA
CATGTCAACACGCACTCTGACTCGGAGCTCTTACTCAACATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCC
CGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGATGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACG
GCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGAGACGAGAATGGCATCCGGCCCCTCTGCCTGGGATCCCGG
CCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCACCCAGCTCGGCTTC
GGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGCGGTTTCGCCAGATT
GTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACAGCTGCATCGACGGC
ATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACACTCTTGGGGAGAAG
GGGGTTGCTGAGATTGATGTTGTGATACCGGTTCCGGAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTAC
CTCAACAAGCCGTTTTCGAATGCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACG
ACACGACAGAAAAGCGTCCGTCGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTC
GATGATTCGATAGTGCGAGGAACCACGTCGCGTGAGATAGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTG
CTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCCTCATGTTTACGGCATAGATCTGGCAGATCCAGCGGAGTTG
ATTGCACACAAAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAA
GATCTTCAAGAAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGC
GGAGAGTACAAAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGG
AAGAATGGAGACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAAC
GTGACGTCGGAGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATC
AGCCTCCACAACTTTGCAGACGAGCGCTGA
Transcript >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGCTGGGCGATTCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTC
TACTTCCTCCAACATCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTATCAGTGCAAG
GGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGCTGGCATCAGC
CATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGA
TTGTCGATGAGCGTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGA
CATGTCAACACGCACTCTGACTCGGAGCTCTTACTCAACATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCC
CGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGATGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACG
GCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGAGACGAGAATGGCATCCGGCCCCTCTGCCTGGGATCCCGG
CCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCACCCAGCTCGGCTTC
GGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGCGGTTTCGCCAGATT
GTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACAGCTGCATCGACGGC
ATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACACTCTTGGGGAGAAG
GGGGTTGCTGAGATTGATGTTGTGATACCGGTTCCGGAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTAC
CTCAACAAGCCGTTTTCGAATGCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACG
ACACGACAGAAAAGCGTCCGTCGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTC
GATGATTCGATAGTGCGAGGAACCACGTCGCGTGAGATAGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTG
CTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCCTCATGTTTACGGCATAGATCTGGCAGATCCAGCGGAGTTG
ATTGCACACAAAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAA
GATCTTCAAGAAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGC
GGAGAGTACAAAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGG
AAGAATGGAGACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAAC
GTGACGTCGGAGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATC
AGCCTCCACAACTTTGCAGACGAGCGCTGA
Gene >Ophun1|6798
ATGTGTGGCGTCACTGCCCTGCTGGTCAGTCTCTCTCCCTGTTCTTGGCCCTGGTCGAAGCTGTGGTCTGAGGCC
TCTTTTCCTGCGCATCTTCCGATGGCTCTGTGAGTCGGCTGGGTTTGGGCTGACTTGTCTTGTCAGCTGGGCGAT
TCAAAGGCCACCACGGCCGCTGTCGACTTGCACGAGGCCCTCTACTTCCTCCAACATGTAAGTGTCTACGTTCTC
ACGGTCCGGATCGAGGATGAAGCCTCTCCGACGCCCCTAAAACCCCCCCAAACTCCTACTCACTGGCGTATTCTT
GCCTTGATGCTGACGCCTGAAATAGCGGGGCCAGGATGCTGCCGGCATCACCGTCTGTCAAGGAGGGAGGCTGTA
TCAGTGCAAGGGCAATGGCATGGCTGCCAAGGTCTTTGCCGAGGGCAAGCGGGTTGCGGATCTGCCTGGCTTTGC
TGGCATCAGCCATCTCAGATACCCAACCGCTGGAACATCGTCTGCGTGCGCTCATCCCGGAGACGGAGCTTTCGG
GACTCGGCTGATGACTCTCTCAGGTCCGAGGCTCAGCCCTTTTACGTCAACTCGCCATTTGGATTGTCGATGAGC
GTCAACGGAAACCTGGTGAACAACGCCGAACTTCGCAATTTCCTCGACCTTGAGGCTCGTCGACATGTCAACACG
CACTCTGACTCGGAGCTCTTGTAAGTCGATCTGTCATCTCTTCTCCTCGCTTTCATCTCACCCTCTCAGACTCAA
CATCTTTGCGCACGCTCTCAACGAGCTGGGAAAAGCCCGGGCCAATGTGGACGACGTTTTCACTGCACTTCGCGA
TGTATACGCCAGATGTCGTGGGGCCTTTGCATGCACGGCCATGATTGCCGGCTTTGGCATTTTAGGCTTCAGGTG
AGTCGTCTGGCCTGCGTCTTGGCAATGGCAACTAAGGCGTCGCATCCAGAGACGAGAATGGCATCCGGCCCCTCT
GCCTGGGATCCCGGCCGTCTGCCACTCTGGATGGGGCGACGGATTACATGATGGCCTCTGAGTCTATTGCTCTCA
CCCAGCTCGGCTTCGGTGACATTGTCGACATTCTGCCCGGCCAGGCCGTCTTCATTGAGAAAGGGGGTGCGCCGC
GGTTTCGCCAGATTGTCGAGCGCAAGTCTTATACGCCCGACATCTTTGAGTATGTCTACTTTGCCCGTCCGGACA
GCTGCATCGACGGCATTTCCGTCCATCGCAGCCGGCAGAAGATGGGCCTGCGGCTTGCCAAGAAGATCAAGGACA
CTCTTGGGGAGAAGGGGGTTGCTGAGATTGATGTTGGTATGCAAGCCGGCAGTCCTTACAGCGCGAGAATTGGTC
AAGATGCTGACCAGCCGTTGAAAAGTGATACCGGTTCCGGAGGTAAAGTGTTTGAGTCGCTCTCGACGTCACACG
CTCACAGATCTCGTCTAGACCAGCAACACAGCTGCAGCCGTCCTCGCCAGCTACCTCAACAAGCCGTTTTCGAAT
GCCTTTGTCAAGAACCGATACGTCTACCGCACGTTTATTCTACCAGGCCAAACGACACGACAGAAAAGCGTCCGT
CGAAAGCTGTCGCCCATTCACTCCGAGTTCCGAGGCAAAGCCGTCTGCCTGGTCGATGATTCGATAGTGCGAGGA
ACCACGTCGCGTGAGATAGTAAGTGGCCGCTACCTAGTGGCATCTCGACCCGAAGAGGTCATGCTGACTATTGGC
TCAGGTGCAGATGGCGAGGGACGCTGGTGCCGTCCGCGTGCTATTCGCCTCTTGCTCCCCTGGAGTGACGCATCC
TCATGTTGTAAGTGAGAGCAGTCTCATCACGTACGGTGCTGACCACGTGGCAGTACGGCATAGATCTGGCAGATC
CAGCGGGTATGAAAGACAACGGAATGGCTCTGCCGGGGAAGAGGCTGACTGAGAATGCAGAGTTGATTGCACACA
AAAAGACTCGGCATGAGATTGCGACGCACATCGATGCCGACGACGTCATATACCAGGACCTCGAAGATCTTCAAG
AAGCCTGCGTAGAAGCGGCAGAAGGCGACAGCGAAGTCAAGGAATTTGAGATTGGCGTCTTTTGCGGAGAGTACA
AAACCGAGGTGCCGGAAGGCTACTTTGAACACCTAAGCCGTCTACGAGAAAGGGGCAAGAAGAGGAAGAATGGAG
ACGTGGACGAAGCAGACGCAAGCACCAAAAAGGCAAGCCTGCTCGCAGACAGCGGACCTCTCAACGTGACGTCGG
AGCCGCAGAAGAGCAACGGCGCGGGGGGAGAAGAAACGGTGGGCGTGAAGCACCGAGGAGACATCAGGTAAGTCT
CTCATGTTGATGTGCGAATGGCGAACTAACAGCAGCGCAGCCTCCACAACTTTGCAGACGAGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail