Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6796
Gene name
LocationContig_778:54..1985
Strand-
Gene length (bp)1931
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00867 XPG_I XPG I-region 1.1E-22 118 203
PF00752 XPG_N XPG N-terminal domain 1.6E-06 33 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53695|EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo1 PE=1 SV=1 1 308 2.0E-80
sp|Q60GC1|EXO1_ORYSJ Exonuclease 1 OS=Oryza sativa subsp. japonica GN=EXO1 PE=2 SV=1 1 318 2.0E-71
sp|P39875|EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXO1 PE=1 SV=2 1 356 3.0E-71
sp|Q8L6Z7|EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana GN=EXO1 PE=2 SV=2 1 337 6.0E-69
sp|Q9W6K2|EXO1_XENLA Exonuclease 1 OS=Xenopus laevis GN=exo1 PE=2 SV=1 1 311 1.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53695|EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo1 PE=1 SV=1 1 308 2.0E-80
sp|Q60GC1|EXO1_ORYSJ Exonuclease 1 OS=Oryza sativa subsp. japonica GN=EXO1 PE=2 SV=1 1 318 2.0E-71
sp|P39875|EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXO1 PE=1 SV=2 1 356 3.0E-71
sp|Q8L6Z7|EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana GN=EXO1 PE=2 SV=2 1 337 6.0E-69
sp|Q9W6K2|EXO1_XENLA Exonuclease 1 OS=Xenopus laevis GN=exo1 PE=2 SV=1 1 311 1.0E-65
sp|Q54ED2|EXO1_DICDI Exonuclease 1 OS=Dictyostelium discoideum GN=exo1 PE=3 SV=1 1 307 7.0E-64
sp|Q9UQ84|EXO1_HUMAN Exonuclease 1 OS=Homo sapiens GN=EXO1 PE=1 SV=2 1 304 5.0E-60
sp|Q9QZ11|EXO1_MOUSE Exonuclease 1 OS=Mus musculus GN=Exo1 PE=2 SV=2 1 311 5.0E-59
sp|Q803U7|EXO1_DANRE Exonuclease 1 OS=Danio rerio GN=exo1 PE=2 SV=1 1 311 1.0E-57
sp|Q12086|DIN7_YEAST DNA damage-inducible protein DIN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIN7 PE=2 SV=1 1 291 9.0E-56
sp|Q24558|EXO1_DROME Exonuclease 1 OS=Drosophila melanogaster GN=tos PE=1 SV=1 1 311 4.0E-53
sp|A5KAL1|FEN1_PLAVS Flap endonuclease 1 OS=Plasmodium vivax (strain Salvador I) GN=FEN1 PE=3 SV=1 31 261 3.0E-21
sp|A8B672|FEN1_GIAIC Flap endonuclease 1 OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=FEN1 PE=3 SV=1 29 230 5.0E-21
sp|B3L014|FEN1_PLAKH Flap endonuclease 1 OS=Plasmodium knowlesi (strain H) GN=FEN1 PE=3 SV=1 31 268 9.0E-21
sp|Q178M1|FEN1_AEDAE Flap endonuclease 1 OS=Aedes aegypti GN=Fen1 PE=3 SV=1 1 255 6.0E-20
sp|Q4UFP0|FEN1_THEAN Flap endonuclease 1 OS=Theileria annulata GN=FEN1 PE=3 SV=1 1 232 1.0E-19
sp|A7RRJ0|FEN1_NEMVE Flap endonuclease 1 OS=Nematostella vectensis GN=FEN1 PE=3 SV=1 1 245 2.0E-19
sp|D3TQJ5|FEN1_GLOMM Flap endonuclease 1 OS=Glossina morsitans morsitans GN=Fen1 PE=2 SV=1 1 248 2.0E-19
sp|Q5ZLN4|FEN1_CHICK Flap endonuclease 1 OS=Gallus gallus GN=FEN1 PE=2 SV=1 1 263 3.0E-19
sp|B3MDA3|FEN1_DROAN Flap endonuclease 1 OS=Drosophila ananassae GN=Fen1 PE=3 SV=1 1 244 4.0E-19
sp|B3RVF0|FEN1_TRIAD Flap endonuclease 1 OS=Trichoplax adhaerens GN=FEN1 PE=3 SV=1 1 257 6.0E-19
sp|B4KNM1|FEN1_DROMO Flap endonuclease 1 OS=Drosophila mojavensis GN=Fen1 PE=3 SV=1 1 254 7.0E-19
sp|Q7Q323|FEN1_ANOGA Flap endonuclease 1 OS=Anopheles gambiae GN=Fen1 PE=3 SV=2 1 255 8.0E-19
sp|B4LM90|FEN1_DROVI Flap endonuclease 1 OS=Drosophila virilis GN=Fen1 PE=3 SV=1 1 244 3.0E-18
sp|B4J6M4|FEN1_DROGR Flap endonuclease 1 OS=Drosophila grimshawi GN=Fen1 PE=3 SV=1 1 244 3.0E-18
sp|Q7K734|FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) GN=FEN1 PE=3 SV=1 31 261 5.0E-18
sp|Q9GZ01|FEN1_PLAFA Flap endonuclease 1 OS=Plasmodium falciparum GN=FEN1 PE=2 SV=1 31 261 5.0E-18
sp|B4MR84|FEN1_DROWI Flap endonuclease 1 OS=Drosophila willistoni GN=Fen1 PE=3 SV=1 1 244 1.0E-17
sp|P39749|FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus GN=Fen1 PE=1 SV=1 1 268 1.0E-17
sp|Q5XIP6|FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus GN=Fen1 PE=2 SV=1 1 268 1.0E-17
sp|P61942|FEN_NANEQ Flap endonuclease 1 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fen PE=3 SV=1 1 246 3.0E-17
sp|A4VDN2|FEN1_TETTS Flap endonuclease 1 OS=Tetrahymena thermophila (strain SB210) GN=FEN1 PE=3 SV=1 1 234 4.0E-17
sp|A7UW97|FEN1_NEUCR Flap endonuclease 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dnr-8 PE=3 SV=2 41 234 5.0E-17
sp|A9VB27|FEN1_MONBE Flap endonuclease 1 OS=Monosiga brevicollis GN=FEN1 PE=3 SV=1 40 256 5.0E-17
sp|A8XL25|FEN1_CAEBR Flap endonuclease 1 OS=Caenorhabditis briggsae GN=crn-1 PE=3 SV=1 1 230 6.0E-17
sp|B4P5U9|FEN1_DROYA Flap endonuclease 1 OS=Drosophila yakuba GN=Fen1 PE=3 SV=1 1 244 6.0E-17
sp|C3ZBT0|FEN1_BRAFL Flap endonuclease 1 OS=Branchiostoma floridae GN=FEN1 PE=3 SV=1 1 233 6.0E-17
sp|Q4XXP8|FEN1_PLACH Flap endonuclease 1 OS=Plasmodium chabaudi GN=FEN1 PE=3 SV=1 1 257 7.0E-17
sp|C4QZ20|FEN1_PICPG Flap endonuclease 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=FEN1 PE=3 SV=1 1 257 9.0E-17
sp|Q97B98|FEN_THEVO Flap endonuclease 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fen PE=3 SV=1 17 222 1.0E-16
sp|B5DUR8|FEN1_DROPS Flap endonuclease 1 OS=Drosophila pseudoobscura pseudoobscura GN=Fen1 PE=3 SV=1 1 244 1.0E-16
sp|B4GIM3|FEN1_DROPE Flap endonuclease 1 OS=Drosophila persimilis GN=Fen1 PE=3 SV=1 1 244 1.0E-16
sp|C5FZT5|FEN1_ARTOC Flap endonuclease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=FEN1 PE=3 SV=1 1 239 1.0E-16
sp|C8BKD0|FEN1_SHEEP Flap endonuclease 1 OS=Ovis aries GN=FEN1 PE=2 SV=1 1 268 2.0E-16
sp|Q6C116|FEN1_YARLI Flap endonuclease 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FEN1 PE=3 SV=1 1 251 2.0E-16
sp|Q9N3T2|FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans GN=crn-1 PE=1 SV=1 1 230 2.0E-16
sp|B4HTA1|FEN1_DROSE Flap endonuclease 1 OS=Drosophila sechellia GN=Fen1 PE=3 SV=1 1 244 2.0E-16
sp|B4QIG6|FEN1_DROSI Flap endonuclease 1 OS=Drosophila simulans GN=Fen1 PE=3 SV=1 1 244 2.0E-16
sp|Q7K7A9|FEN1_DROME Flap endonuclease 1 OS=Drosophila melanogaster GN=Fen1 PE=2 SV=1 1 244 2.0E-16
sp|D1ZT73|FEN1_SORMK Flap endonuclease 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=FEN1 PE=3 SV=1 41 234 2.0E-16
sp|Q5I4H3|FEN1_XIPMA Flap endonuclease 1 OS=Xiphophorus maculatus GN=fen1 PE=2 SV=1 1 256 3.0E-16
sp|B3NP61|FEN1_DROER Flap endonuclease 1 OS=Drosophila erecta GN=Fen1 PE=3 SV=1 1 244 3.0E-16
sp|Q5UQW7|YL386_MIMIV Putative endonuclease L386 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L386 PE=3 SV=1 31 241 4.0E-16
sp|B9EMY6|FEN1_SALSA Flap endonuclease 1 OS=Salmo salar GN=fen1 PE=2 SV=1 1 257 5.0E-16
sp|C6TEX6|FEN1_SOYBN Flap endonuclease 1 OS=Glycine max GN=FEN1 PE=2 SV=1 1 244 5.0E-16
sp|Q6L2I9|FEN_PICTO Flap endonuclease 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fen PE=3 SV=1 29 232 6.0E-16
sp|Q7RME3|FEN1_PLAYO Flap endonuclease 1 OS=Plasmodium yoelii yoelii GN=FEN1 PE=3 SV=1 1 257 6.0E-16
sp|Q58839|FEN_METJA Flap endonuclease 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fen PE=1 SV=1 36 244 8.0E-16
sp|Q58DH8|FEN1_BOVIN Flap endonuclease 1 OS=Bos taurus GN=FEN1 PE=2 SV=1 1 268 8.0E-16
sp|B6AFP1|FEN1_CRYMR Flap endonuclease 1 OS=Cryptosporidium muris (strain RN66) GN=FEN1 PE=3 SV=1 31 233 9.0E-16
sp|Q4P1V1|FEN1_USTMA Flap endonuclease 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FEN1 PE=3 SV=1 1 239 1.0E-15
sp|Q54NU0|FEN1_DICDI Flap endonuclease 1 OS=Dictyostelium discoideum GN=repG PE=3 SV=1 1 233 1.0E-15
sp|C5DGG4|FEN1_LACTC Flap endonuclease 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=FEN1 PE=3 SV=1 1 256 2.0E-15
sp|Q5B9L6|FEN1_EMENI Flap endonuclease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fen1 PE=3 SV=1 41 234 2.0E-15
sp|Q4N3S6|FEN1_THEPA Flap endonuclease 1 OS=Theileria parva GN=FEN1 PE=3 SV=1 37 232 2.0E-15
sp|B0EN90|FEN1_ENTDS Flap endonuclease 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=FEN1 PE=3 SV=1 1 257 2.0E-15
sp|A5UL52|FEN_METS3 Flap endonuclease 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fen PE=3 SV=1 1 242 2.0E-15
sp|P39748|FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens GN=FEN1 PE=1 SV=1 1 268 2.0E-15
sp|Q6TNU4|FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio GN=fen1 PE=2 SV=1 1 230 2.0E-15
sp|A4QS18|FEN1_MAGO7 Flap endonuclease 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FEN1 PE=3 SV=2 1 234 3.0E-15
sp|Q4R5U5|FEN1_MACFA Flap endonuclease 1 OS=Macaca fascicularis GN=FEN1 PE=2 SV=1 1 268 3.0E-15
sp|A0CXT3|FEN11_PARTE Flap endonuclease 1-1 OS=Paramecium tetraurelia GN=FEN1-1 PE=3 SV=1 48 258 3.0E-15
sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis GN=fen1-a PE=1 SV=1 1 256 3.0E-15
sp|C4M6G8|FEN1_ENTHI Flap endonuclease 1 OS=Entamoeba histolytica GN=FEN1 PE=3 SV=1 1 257 5.0E-15
sp|A3M056|FEN1_PICST Flap endonuclease 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FEN1 PE=3 SV=2 1 233 5.0E-15
sp|C7Z125|FEN1_NECH7 Flap endonuclease 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=FEN1 PE=3 SV=1 1 239 5.0E-15
sp|C1BM18|FEN1_OSMMO Flap endonuclease 1 OS=Osmerus mordax GN=fen1 PE=2 SV=1 1 256 5.0E-15
sp|O65251|FEN1_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana GN=FEN1 PE=2 SV=2 1 244 6.0E-15
sp|Q4Z015|FEN1_PLABA Flap endonuclease 1 OS=Plasmodium berghei (strain Anka) GN=FEN1 PE=3 SV=1 1 256 7.0E-15
sp|Q0CBS0|FEN1_ASPTN Flap endonuclease 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fen1 PE=3 SV=2 41 257 7.0E-15
sp|C3KJE6|FEN1_ANOFI Flap endonuclease 1 OS=Anoplopoma fimbria GN=fen1 PE=2 SV=1 1 264 8.0E-15
sp|Q9HJD4|FEN_THEAC Flap endonuclease 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fen PE=3 SV=1 17 233 8.0E-15
sp|C5YUK3|FEN11_SORBI Flap endonuclease 1-A OS=Sorghum bicolor GN=FEN1-A PE=3 SV=1 29 244 9.0E-15
sp|A8J2Z9|FEN1_CHLRE Flap endonuclease 1 OS=Chlamydomonas reinhardtii GN=FEN1 PE=3 SV=1 29 233 9.0E-15
sp|P70054|FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis GN=fen1-b PE=1 SV=1 1 256 1.0E-14
sp|A0CYG2|FEN12_PARTE Flap endonuclease 1-2 OS=Paramecium tetraurelia GN=FEN1-2 PE=3 SV=1 48 258 1.0E-14
sp|B8AW67|FEN11_ORYSI Flap endonuclease 1-A OS=Oryza sativa subsp. indica GN=FEN1a PE=3 SV=1 29 244 1.0E-14
sp|Q9SXQ6|FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica GN=FEN-1a PE=2 SV=1 29 244 2.0E-14
sp|C4YBJ8|FEN1_CLAL4 Flap endonuclease 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=FEN1 PE=3 SV=2 1 234 2.0E-14
sp|C4JDR3|FEN1_UNCRE Flap endonuclease 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=FEN1 PE=3 SV=2 41 234 2.0E-14
sp|B1H158|FEN1_XENTR Flap endonuclease 1 OS=Xenopus tropicalis GN=fen1 PE=2 SV=1 1 256 3.0E-14
sp|B8MNF2|FEN1_TALSN Flap endonuclease 1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=fen1 PE=3 SV=2 48 239 3.0E-14
sp|Q0W6I0|FEN_METAR Flap endonuclease 1 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=fen PE=3 SV=1 29 222 4.0E-14
sp|C5WU23|FEN12_SORBI Flap endonuclease 1-B OS=Sorghum bicolor GN=FEN1-B PE=3 SV=2 31 234 6.0E-14
sp|A5ABU3|FEN1_ASPNC Flap endonuclease 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fen1 PE=3 SV=1 41 239 6.0E-14
sp|Q9ATY5|UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana GN=UVH3 PE=2 SV=1 57 220 6.0E-14
sp|O29975|FEN_ARCFU Flap endonuclease 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fen PE=1 SV=1 17 242 6.0E-14
sp|Q0UZR3|FEN1_PHANO Flap endonuclease 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FEN1 PE=3 SV=3 41 263 6.0E-14
sp|A5E121|FEN1_LODEL Flap endonuclease 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FEN1 PE=3 SV=1 1 234 7.0E-14
sp|A8AAC1|FEN_IGNH4 Flap endonuclease 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fen PE=3 SV=1 1 271 8.0E-14
sp|A9U328|FEN12_PHYPA Flap endonuclease 1-B OS=Physcomitrella patens subsp. patens GN=FEN1-B PE=3 SV=1 48 234 8.0E-14
sp|A1D8A4|FEN1_NEOFI Flap endonuclease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fen1 PE=3 SV=1 41 257 8.0E-14
sp|Q75LI2|FEN12_ORYSJ Flap endonuclease 1-B OS=Oryza sativa subsp. japonica GN=FEN-1b PE=2 SV=1 1 244 1.0E-13
sp|B8AMS4|FEN12_ORYSI Flap endonuclease 1-B OS=Oryza sativa subsp. indica GN=FEN1b PE=3 SV=1 1 244 1.0E-13
sp|P39750|FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad2 PE=1 SV=1 1 231 1.0E-13
sp|B6QT52|FEN1_TALMQ Flap endonuclease 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=fen1 PE=3 SV=2 48 239 1.0E-13
sp|C5DZA9|FEN1_ZYGRC Flap endonuclease 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=FEN1 PE=3 SV=1 1 234 1.0E-13
sp|B1L6R9|FEN_KORCO Flap endonuclease 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=fen PE=3 SV=1 48 236 2.0E-13
sp|Q8ZYN2|FEN_PYRAE Flap endonuclease 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fen PE=3 SV=1 1 230 2.0E-13
sp|D0MY34|FEN1_PHYIT Flap endonuclease 1 OS=Phytophthora infestans (strain T30-4) GN=FEN1 PE=3 SV=1 29 234 2.0E-13
sp|B0XZ33|FEN1_ASPFC Flap endonuclease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=fen1 PE=3 SV=2 41 257 2.0E-13
sp|A3FPN7|FEN1_CRYPI Flap endonuclease 1 OS=Cryptosporidium parvum (strain Iowa II) GN=FEN1 PE=3 SV=1 31 233 2.0E-13
sp|Q4WWJ1|FEN1_ASPFU Flap endonuclease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fen1 PE=3 SV=2 41 257 2.0E-13
sp|A6UX46|FEN_META3 Flap endonuclease 1 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fen PE=3 SV=1 37 236 2.0E-13
sp|B4FHY0|FEN1_MAIZE Flap endonuclease 1 OS=Zea mays GN=FEN1 PE=2 SV=1 29 244 2.0E-13
sp|Q6FM28|FEN1_CANGA Flap endonuclease 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FEN1 PE=3 SV=1 1 234 3.0E-13
sp|Q976H6|FEN_SULTO Flap endonuclease 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fen PE=3 SV=2 29 230 3.0E-13
sp|A1RWY2|FEN_THEPD Flap endonuclease 1 OS=Thermofilum pendens (strain Hrk 5) GN=fen PE=3 SV=1 29 271 6.0E-13
sp|A7TJ59|FEN1_VANPO Flap endonuclease 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FEN1 PE=3 SV=1 1 234 7.0E-13
sp|A1CJ75|FEN1_ASPCL Flap endonuclease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fen1 PE=3 SV=2 41 239 7.0E-13
sp|Q4DKQ5|FEN1_TRYCC Flap endonuclease 1 OS=Trypanosoma cruzi (strain CL Brener) GN=FEN1 PE=3 SV=1 1 277 1.0E-12
sp|B7XHS8|FEN1_ENTBH Flap endonuclease 1 OS=Enterocytozoon bieneusi (strain H348) GN=FEN1 PE=3 SV=1 48 235 1.0E-12
sp|C5M2X8|FEN1_CANTT Flap endonuclease 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RAD27 PE=3 SV=1 1 234 1.0E-12
sp|A8M9L3|FEN_CALMQ Flap endonuclease 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=fen PE=3 SV=1 29 222 1.0E-12
sp|B0UXL7|FEN1B_DANRE Probable flap endonuclease 1 homolog OS=Danio rerio GN=si:dkeyp-13a3.3 PE=2 SV=1 1 256 1.0E-12
sp|A4WNC4|FEN_PYRAR Flap endonuclease 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fen PE=3 SV=1 29 230 2.0E-12
sp|B6JYI7|FEN1_SCHJY Flap endonuclease 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rad2 PE=3 SV=1 1 231 2.0E-12
sp|A7AX58|FEN1_BABBO Flap endonuclease 1 OS=Babesia bovis GN=FEN1 PE=3 SV=1 31 245 2.0E-12
sp|A3DMG2|FEN_STAMF Flap endonuclease 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fen PE=3 SV=1 2 233 2.0E-12
sp|Q6CLH4|FEN1_KLULA Flap endonuclease 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FEN1 PE=3 SV=1 40 241 3.0E-12
sp|A8QCH0|FEN1_BRUMA Flap endonuclease 1 OS=Brugia malayi GN=FEN1 PE=3 SV=1 1 257 4.0E-12
sp|B9WLQ5|FEN1_CANDC Flap endonuclease 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RAD27 PE=3 SV=1 1 234 4.0E-12
sp|Q5A6K8|FEN1_CANAL Flap endonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD27 PE=3 SV=1 1 234 4.0E-12
sp|Q3IPG8|FEN_NATPD Flap endonuclease 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fen PE=3 SV=1 41 222 4.0E-12
sp|C4YLS2|FEN1_CANAW Flap endonuclease 1 OS=Candida albicans (strain WO-1) GN=RAD27 PE=3 SV=1 1 234 4.0E-12
sp|B3LQY3|FEN1_YEAS1 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RAD27 PE=3 SV=1 1 234 5.0E-12
sp|Q980U8|FEN_SULSO Flap endonuclease 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fen PE=1 SV=2 29 243 5.0E-12
sp|A7IA59|FEN_METB6 Flap endonuclease 1 OS=Methanoregula boonei (strain 6A8) GN=fen PE=3 SV=1 29 229 5.0E-12
sp|A4S1G4|FEN1_OSTLU Flap endonuclease 1 OS=Ostreococcus lucimarinus (strain CCE9901) GN=FEN1 PE=3 SV=1 29 236 6.0E-12
sp|B7G7Y7|FEN1_PHATC Flap endonuclease 1 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=FEN1 PE=3 SV=1 1 245 6.0E-12
sp|Q013G9|FEN1_OSTTA Flap endonuclease 1 OS=Ostreococcus tauri GN=FEN1 PE=3 SV=2 29 236 7.0E-12
sp|C5JVG7|FEN1_AJEDS Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=FEN1 PE=3 SV=2 48 239 7.0E-12
sp|C5GPA7|FEN1_AJEDR Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=FEN1 PE=3 SV=2 48 239 7.0E-12
sp|P26793|FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD27 PE=1 SV=1 1 234 8.0E-12
sp|C8ZC62|FEN1_YEAS8 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RAD27 PE=3 SV=1 1 234 8.0E-12
sp|A6ZZK4|FEN1_YEAS7 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RAD27 PE=3 SV=1 1 234 8.0E-12
sp|C7GVJ8|FEN1_YEAS2 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RAD27 PE=3 SV=1 1 234 8.0E-12
sp|B8NV37|FEN1_ASPFN Flap endonuclease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=fen1 PE=3 SV=1 41 239 8.0E-12
sp|Q2NFD4|FEN_METST Flap endonuclease 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fen PE=3 SV=1 16 234 8.0E-12
sp|A0B9M7|FEN_METTP Flap endonuclease 1 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fen PE=3 SV=1 29 257 9.0E-12
sp|A2SQC6|FEN_METLZ Flap endonuclease 1 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fen PE=3 SV=1 29 229 1.0E-11
sp|Q75DS8|FEN1_ASHGO Flap endonuclease 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FEN1 PE=3 SV=2 1 244 1.0E-11
sp|A3CWV2|FEN_METMJ Flap endonuclease 1 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fen PE=3 SV=1 48 224 1.0E-11
sp|D2V434|FEN1_NAEGR Flap endonuclease 1 OS=Naegleria gruberi GN=FEN1 PE=3 SV=1 1 239 1.0E-11
sp|D3BN56|FEN1_POLPA Flap endonuclease 1 OS=Polysphondylium pallidum GN=repG PE=3 SV=1 1 231 1.0E-11
sp|A9S0B8|FEN11_PHYPA Flap endonuclease 1-A OS=Physcomitrella patens subsp. patens GN=FEN1-A PE=3 SV=1 29 234 2.0E-11
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 101 212 2.0E-11
sp|B2VTT3|FEN1_PYRTR Flap endonuclease 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=fen1 PE=3 SV=2 48 234 2.0E-11
sp|A4I2L4|FEN1_LEIIN Flap endonuclease 1 OS=Leishmania infantum GN=FEN1 PE=3 SV=1 1 276 2.0E-11
sp|C6HQJ2|FEN1_AJECH Flap endonuclease 1 OS=Ajellomyces capsulatus (strain H143) GN=FEN1 PE=3 SV=2 48 239 2.0E-11
sp|A6QV55|FEN1_AJECN Flap endonuclease 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FEN1 PE=3 SV=1 48 239 2.0E-11
sp|Q6BLF4|FEN1_DEBHA Flap endonuclease 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FEN1 PE=3 SV=2 1 233 2.0E-11
sp|A1RSC7|FEN_PYRIL Flap endonuclease 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fen PE=3 SV=1 1 235 3.0E-11
sp|A2BMI0|FEN_HYPBU Flap endonuclease 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=fen PE=3 SV=1 29 234 4.0E-11
sp|B6HEM2|FEN1_PENRW Flap endonuclease 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=fen1 PE=3 SV=1 41 239 4.0E-11
sp|A8NQC2|FEN1_COPC7 Flap endonuclease 1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=FEN1 PE=3 SV=3 1 233 5.0E-11
sp|Q2FNC9|FEN_METHJ Flap endonuclease 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=fen PE=3 SV=1 1 224 6.0E-11
sp|B0DSN9|FEN11_LACBS Flap endonuclease 1-A OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN11 PE=3 SV=1 1 234 7.0E-11
sp|O27670|FEN_METTH Flap endonuclease 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fen PE=3 SV=1 29 234 8.0E-11
sp|Q91FF5|VF369_IIV6 Probable RAD2-like endonuclease 369L OS=Invertebrate iridescent virus 6 GN=IIV6-369L PE=3 SV=1 30 233 9.0E-11
sp|Q5V5T7|FEN_HALMA Flap endonuclease 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fen PE=3 SV=1 41 222 1.0E-10
sp|Q12UT1|FEN_METBU Flap endonuclease 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fen PE=3 SV=1 29 233 2.0E-10
sp|A5DCF5|FEN1_PICGU Flap endonuclease 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FEN1 PE=3 SV=3 1 234 3.0E-10
sp|P0CS60|FEN1_CRYNJ Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FEN1 PE=3 SV=1 40 234 3.0E-10
sp|P0CS61|FEN1_CRYNB Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FEN1 PE=3 SV=1 40 234 3.0E-10
sp|B1YC46|FEN_PYRNV Flap endonuclease 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fen PE=3 SV=1 29 230 3.0E-10
sp|B8GIA0|FEN_METPE Flap endonuclease 1 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fen PE=3 SV=1 41 222 3.0E-10
sp|Q4FYU7|FEN1_LEIMA Flap endonuclease 1 OS=Leishmania major GN=FEN1 PE=3 SV=1 1 233 3.0E-10
sp|P35689|ERCC5_MOUSE DNA repair protein complementing XP-G cells homolog OS=Mus musculus GN=Ercc5 PE=1 SV=4 90 243 3.0E-10
sp|Q76F73|FEN1_COPCI Flap endonuclease 1 OS=Coprinopsis cinerea GN=FEN1 PE=2 SV=1 1 233 4.0E-10
sp|Q9YFY5|FEN_AERPE Flap endonuclease 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fen PE=3 SV=3 29 230 5.0E-10
sp|A3MY15|FEN_PYRCJ Flap endonuclease 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fen PE=3 SV=1 1 271 5.0E-10
sp|Q8BMI4|GEN_MOUSE Flap endonuclease GEN homolog 1 OS=Mus musculus GN=Gen1 PE=1 SV=2 1 235 6.0E-10
sp|B0E412|FEN12_LACBS Flap endonuclease 1-B OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN12 PE=3 SV=1 1 234 7.0E-10
sp|C9ZKW4|FEN1_TRYB9 Flap endonuclease 1 OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=FEN1 PE=3 SV=1 1 233 8.0E-10
sp|Q57WW6|FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=FEN1 PE=3 SV=1 1 233 8.0E-10
sp|A4HFE4|FEN1_LEIBR Flap endonuclease 1 OS=Leishmania braziliensis GN=FEN1 PE=3 SV=1 1 217 8.0E-10
sp|P14629|ERCC5_XENLA DNA repair protein complementing XP-G cells homolog OS=Xenopus laevis GN=ercc5 PE=2 SV=1 102 235 1.0E-09
sp|O50123|FEN_PYRHO Flap endonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fen PE=1 SV=1 29 226 1.0E-09
sp|Q17RS7|GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens GN=GEN1 PE=1 SV=2 1 225 1.0E-09
sp|P28715|ERCC5_HUMAN DNA repair protein complementing XP-G cells OS=Homo sapiens GN=ERCC5 PE=1 SV=3 72 222 1.0E-09
sp|O93634|FEN_PYRFU Flap endonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fen PE=1 SV=1 29 226 2.0E-09
sp|C6A1U9|FEN_THESM Flap endonuclease 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fen PE=3 SV=1 29 226 2.0E-09
sp|Q9V0P9|FEN_PYRAB Flap endonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fen PE=3 SV=1 29 226 4.0E-09
sp|Q4JAN1|FEN_SULAC Flap endonuclease 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fen PE=3 SV=2 29 230 6.0E-09
sp|C1E3X9|FEN1_MICSR Flap endonuclease 1 OS=Micromonas sp. (strain RCC299 / NOUM17) GN=FEN1 PE=3 SV=1 40 244 6.0E-09
sp|B8C6S5|FEN1_THAPS Flap endonuclease 1 OS=Thalassiosira pseudonana GN=FEN1 PE=3 SV=1 48 261 1.0E-08
sp|Q8TXU4|FEN_METKA Flap endonuclease 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fen PE=1 SV=1 1 222 1.0E-08
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 105 222 1.0E-08
sp|Q8W5R1|GENL2_ORYSJ Flap endonuclease GEN-like 2 OS=Oryza sativa subsp. japonica GN=SEND1 PE=2 SV=1 1 221 7.0E-08
sp|P40028|YEN1_YEAST Holliday junction resolvase YEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEN1 PE=1 SV=2 33 166 8.0E-08
sp|Q8SS91|FEN1_ENCCU Flap endonuclease 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=FEN1 PE=3 SV=1 24 231 9.0E-08
sp|A0RU95|FEN_CENSY Flap endonuclease 1 OS=Cenarchaeum symbiosum (strain A) GN=fen PE=3 SV=1 29 232 2.0E-07
sp|Q9VRJ0|GEN_DROME Flap endonuclease GEN OS=Drosophila melanogaster GN=Gen PE=1 SV=1 1 245 2.0E-07
sp|Q8PYF6|FEN_METMA Flap endonuclease 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fen PE=3 SV=1 29 231 2.0E-07
sp|Q46D63|FEN_METBF Flap endonuclease 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fen PE=3 SV=1 29 231 2.0E-07
sp|Q18HK0|FEN_HALWD Flap endonuclease 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=fen PE=3 SV=1 41 216 7.0E-07
sp|Q29FC1|GEN_DROPS Flap endonuclease GEN OS=Drosophila pseudoobscura pseudoobscura GN=Gen PE=3 SV=1 114 204 2.0E-06
sp|Q5JGN0|FEN_THEKO Flap endonuclease 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fen PE=3 SV=1 29 226 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004518 nuclease activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1367
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4062
Ophiocordyceps australis map64 (Brazil) OphauB2|7903
Ophiocordyceps camponoti-floridani Ophcf2|05258
Ophiocordyceps camponoti-rufipedis Ophun1|6796 (this protein)
Ophiocordyceps kimflemingae Ophio5|1971
Ophiocordyceps subramaniannii Hirsu2|10792

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6796
MGVSGLLPLLKSTHRPTEIKKYKGKTLGVDAFVKSAMHRVKMLRHFDITPYMVFDGDFLPSKAATEESRAKNRQE
KRRMALELMKAGKSAQAAQEFQKCIDITPQMASMLIQELKKMGIPYVVAPYEADAQLVYLERHGFVDGIISDDSD
LLVFGAKRLLTKLDQYGNCVEVNRRDFCACREVSLAGWTDTEFRRMAILSGCDYLDNLPGVGLKTAYRLLRKGKT
PERVVRMLQFEGKRVSENYLTQFYQAEMTFLHQWVFCPTKKKLVHLTELDEKRTAEEMPFIGSYVEPELARAVAA
GDVDPITKKPIMLQTTPSKRRHSQAMPTLATQPPSKPINSYFKGANRIPMGEMDPNCFSIDAQRVAQITQGGLVP
RVFPLPRPYVDEFRRGRAKAPEQADANPSQTSPRLGQVGQRRTEPQASSQPEAVNNPAPSRSVSDGTGSLAAKSQ
PNRPIKKVRLCGDVDDDDKSPKRSKFFPSPKPKGPRRTASEPYLLSDDSIEAALGELPDVDGWASVQKREKPVAV
FRDATPSCNKIGVNGRKDADNGIPEDSAA*
Coding >Ophun1|6796
ATGGGTGTATCGGGCTTATTACCTCTCCTCAAGTCCACTCATCGGCCGACGGAAATCAAAAAGTACAAGGGCAAG
ACCCTCGGGGTCGACGCGTTTGTCAAGTCGGCCATGCATCGCGTCAAGATGCTCCGTCACTTCGATATTACGCCG
TACATGGTATTCGACGGCGACTTTCTTCCCAGCAAAGCCGCCACCGAAGAGTCCCGAGCCAAGAACCGGCAGGAA
AAAAGAAGGATGGCTCTCGAACTGATGAAGGCGGGAAAATCAGCCCAGGCAGCCCAGGAGTTCCAGAAGTGCATC
GACATTACACCCCAGATGGCATCGATGCTCATCCAAGAACTCAAGAAGATGGGAATCCCATATGTCGTCGCTCCT
TACGAGGCCGACGCTCAGCTGGTCTACCTCGAACGACACGGCTTCGTCGATGGCATCATCTCGGACGACTCCGAC
CTTCTCGTCTTCGGCGCCAAGCGTCTCTTGACCAAGCTGGATCAGTACGGCAACTGTGTCGAGGTCAACCGCCGG
GACTTTTGCGCTTGTCGGGAAGTCTCGCTGGCCGGCTGGACCGACACCGAATTCCGCCGCATGGCCATCCTCAGC
GGCTGCGATTACCTCGATAATCTTCCCGGCGTAGGGCTAAAGACGGCCTACCGCTTGCTTCGAAAAGGCAAGACG
CCCGAGCGCGTCGTCCGCATGCTACAGTTTGAAGGGAAGCGCGTCTCGGAGAACTATCTGACGCAGTTCTACCAA
GCCGAGATGACCTTTTTGCATCAATGGGTTTTCTGCCCTACCAAAAAGAAGCTGGTCCATCTGACGGAACTTGAT
GAAAAGCGGACAGCGGAAGAGATGCCCTTTATCGGCAGCTATGTCGAGCCGGAGCTTGCCAGGGCAGTGGCAGCA
GGTGACGTCGACCCTATAACCAAGAAGCCCATCATGCTTCAGACGACGCCGTCCAAGCGAAGACACTCACAAGCC
ATGCCGACTCTCGCTACTCAGCCGCCGTCCAAGCCCATCAACTCGTACTTTAAAGGCGCCAATCGGATCCCAATG
GGTGAAATGGACCCCAATTGCTTCTCCATCGACGCTCAGAGGGTCGCGCAAATCACTCAAGGGGGCCTGGTGCCG
CGCGTCTTCCCCCTGCCCCGACCATATGTCGATGAGTTCCGCCGCGGTCGAGCCAAGGCCCCGGAGCAGGCCGAC
GCGAATCCGTCCCAGACGTCGCCTCGACTCGGACAAGTCGGACAACGGCGGACGGAGCCACAGGCGAGCTCACAG
CCGGAGGCAGTCAATAATCCGGCTCCCTCTCGCTCCGTCTCCGATGGAACCGGCTCACTCGCGGCCAAGTCGCAG
CCAAACAGGCCCATCAAAAAGGTGCGCCTATGCGGCGATGTCGACGACGACGACAAGTCCCCAAAGCGCAGCAAG
TTCTTCCCCTCGCCCAAACCCAAAGGCCCAAGGAGGACCGCAAGCGAACCGTATCTGCTATCGGACGACTCCATC
GAGGCTGCCCTCGGTGAACTTCCCGATGTCGATGGCTGGGCATCGGTTCAGAAGCGCGAGAAGCCAGTCGCCGTC
TTCCGAGACGCAACTCCCAGCTGCAACAAGATTGGCGTAAACGGTCGGAAAGATGCAGACAACGGTATCCCCGAA
GACTCAGCCGCCTGA
Transcript >Ophun1|6796
ATGGGTGTATCGGGCTTATTACCTCTCCTCAAGTCCACTCATCGGCCGACGGAAATCAAAAAGTACAAGGGCAAG
ACCCTCGGGGTCGACGCGTTTGTCAAGTCGGCCATGCATCGCGTCAAGATGCTCCGTCACTTCGATATTACGCCG
TACATGGTATTCGACGGCGACTTTCTTCCCAGCAAAGCCGCCACCGAAGAGTCCCGAGCCAAGAACCGGCAGGAA
AAAAGAAGGATGGCTCTCGAACTGATGAAGGCGGGAAAATCAGCCCAGGCAGCCCAGGAGTTCCAGAAGTGCATC
GACATTACACCCCAGATGGCATCGATGCTCATCCAAGAACTCAAGAAGATGGGAATCCCATATGTCGTCGCTCCT
TACGAGGCCGACGCTCAGCTGGTCTACCTCGAACGACACGGCTTCGTCGATGGCATCATCTCGGACGACTCCGAC
CTTCTCGTCTTCGGCGCCAAGCGTCTCTTGACCAAGCTGGATCAGTACGGCAACTGTGTCGAGGTCAACCGCCGG
GACTTTTGCGCTTGTCGGGAAGTCTCGCTGGCCGGCTGGACCGACACCGAATTCCGCCGCATGGCCATCCTCAGC
GGCTGCGATTACCTCGATAATCTTCCCGGCGTAGGGCTAAAGACGGCCTACCGCTTGCTTCGAAAAGGCAAGACG
CCCGAGCGCGTCGTCCGCATGCTACAGTTTGAAGGGAAGCGCGTCTCGGAGAACTATCTGACGCAGTTCTACCAA
GCCGAGATGACCTTTTTGCATCAATGGGTTTTCTGCCCTACCAAAAAGAAGCTGGTCCATCTGACGGAACTTGAT
GAAAAGCGGACAGCGGAAGAGATGCCCTTTATCGGCAGCTATGTCGAGCCGGAGCTTGCCAGGGCAGTGGCAGCA
GGTGACGTCGACCCTATAACCAAGAAGCCCATCATGCTTCAGACGACGCCGTCCAAGCGAAGACACTCACAAGCC
ATGCCGACTCTCGCTACTCAGCCGCCGTCCAAGCCCATCAACTCGTACTTTAAAGGCGCCAATCGGATCCCAATG
GGTGAAATGGACCCCAATTGCTTCTCCATCGACGCTCAGAGGGTCGCGCAAATCACTCAAGGGGGCCTGGTGCCG
CGCGTCTTCCCCCTGCCCCGACCATATGTCGATGAGTTCCGCCGCGGTCGAGCCAAGGCCCCGGAGCAGGCCGAC
GCGAATCCGTCCCAGACGTCGCCTCGACTCGGACAAGTCGGACAACGGCGGACGGAGCCACAGGCGAGCTCACAG
CCGGAGGCAGTCAATAATCCGGCTCCCTCTCGCTCCGTCTCCGATGGAACCGGCTCACTCGCGGCCAAGTCGCAG
CCAAACAGGCCCATCAAAAAGGTGCGCCTATGCGGCGATGTCGACGACGACGACAAGTCCCCAAAGCGCAGCAAG
TTCTTCCCCTCGCCCAAACCCAAAGGCCCAAGGAGGACCGCAAGCGAACCGTATCTGCTATCGGACGACTCCATC
GAGGCTGCCCTCGGTGAACTTCCCGATGTCGATGGCTGGGCATCGGTTCAGAAGCGCGAGAAGCCAGTCGCCGTC
TTCCGAGACGCAACTCCCAGCTGCAACAAGATTGGCGTAAACGGTCGGAAAGATGCAGACAACGGTATCCCCGAA
GACTCAGCCGCCTGA
Gene >Ophun1|6796
ATGGGTGTATCGGGTCTGTCTACCCAGCCTCACTCCTCACCTCTCGACCGTTCCGCTGACCGTGTGCAAGGCTTA
TTACCTCTCCTCAAGTCCACTCATCGGCCGACGGAAATCAAAAAGTACAAGGGCAAGACCCTCGGGGTCGACGCG
TACGGATGGCTGCACAGGGCAGCGTATTGCTGCGCCGTCGAGCTCGGACAGGATGAGCCCACCACAAAGTATGCC
TCCGTCCCTTGTTCCGTTGGACGGTTAGATGAGCTCTGGAGTCTGACGATGCCGGCGCAGGTTTGTCAAGTCGGC
CATGCATCGCGTCAAGATGCTCCGTCACTTCGATATTACGCCGTACATGGTATTCGACGGCGACTTTCTTCCCAG
CAAAGCCGCCACCGAAGAGTCCCGAGCCAAGAACCGGCAGGAAAAAAGAAGGATGGCTCTCGAACTGATGAAGGC
GGGAAAATCAGCCCAGGCAGCCCAGGAGTTCCAGAAGTGCATCGACATTACACCCCAGATGGCATCGATGCTCAT
CCAAGAACTCAAGAAGATGGGAATCCCATATGTCGTCGCTCCTTACGAGGCCGACGCTCAGCTGGTCTACCTCGA
ACGACACGGCTTCGTCGATGGCATCATCTCGGACGACTCCGACCTTCTCGTCTTCGGCGCCAAGCGTCTCTTGAC
CAAGCTGGATCAGTACGGCAACTGTGTCGAGGTCAACCGCCGGGACTTTTGCGCTTGTCGGGAAGTCTCGCTGGC
CGGCTGGACCGACACCGAATTCCGCCGCATGGCCATCCTCAGCGGCTGCGATTACCTCGATAATCTTCCCGGCGT
AGGGCTAAAGACGGCCTACCGCTTGCTTCGAAAAGGCAAGACGCCCGAGCGCGTCGTCCGCATGCTACAGTTTGA
AGGGAAGCGCGTCTCGGAGAACTATCTGACGCAGTTCTACCAAGCCGAGATGACCTTTTTGCATCAATGGGTTTT
CTGCCCTACCAAAAAGAAGCTGGTCCATCTGACGGAACTTGATGAAAAGCGGACAGCGGAAGAGATGCCCTTTAT
CGGCAGCTATGTCGAGCCGGAGCTTGCCAGGGCAGTGGCAGCAGGTGACGTCGACCCTATAACCAAGAAGCCCAT
CATGCTTCAGACGACGCCGTCCAAGCGAAGACACTCACAAGCCATGCCGACTCTCGCTACTCAGCCGCCGTCCAA
GCCCATCAACTCGTACTTTAAAGGCGCCAATCGGATCCCAATGGGTGAAATGGACCCCAATTGCTTCTCCATCGA
CGCTCAGAGGGTCGCGCAAATCACTCAAGGGGGCCTGGTGCCGCGCGTCTTCCCCCTGCCCCGACCATATGTCGA
TGAGTTCCGCCGCGGTCGAGCCAAGGCCCCGGAGCAGGCCGACGCGAATCCGTCCCAGACGTCGCCTCGACTCGG
ACAAGTCGGACAACGGCGGACGGAGCCACAGGCGAGCTCACAGCCGGAGGCAGTCAATAATCCGGCTCCCTCTCG
CTCCGTCTCCGATGGAACCGGCTCACTCGCGGCCAAGTCGCAGCCAAACAGGCCCATCAAAAAGGTGCGCCTATG
CGGCGATGTCGACGACGACGACAAGTCCCCAAAGCGCAGCAAGTTCTTCCCCTCGCCCAAACCCAAAGGCCCAAG
GAGGACCGCAAGCGAACCGTATCTGCTATCGGACGACTCCATCGAGGCTGCCCTCGGTGAACTTCCCGATGTCGA
TGGCTGGGCATCGGTTCAGAAGCGCGAGAAGCCAGTCGCCGTCTTCCGAGACGCAACTCCCAGCTGCAACAAGAT
TGGCGTAAACGGTCGGAAAGATGCAGACAACGGTATCCCCGAAGACTCAGCCGCGTCACCAACGAAACTCCTCCA
CAAAGCGTCAACCAACTCTCTCCCCCCCCCGACGTCAACAAAGCTCCCCAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail