Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|679
Gene name
LocationContig_1210:517..1848
Strand+
Gene length (bp)1331
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.9E-20 54 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 44 302 4.0E-24
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 52 217 4.0E-15
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 52 291 4.0E-10
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 37 288 7.0E-10
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 41 220 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 44 302 4.0E-24
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 52 217 4.0E-15
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 52 291 4.0E-10
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 37 288 7.0E-10
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 41 220 2.0E-08
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 44 220 1.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 51 212 2.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 52 216 3.0E-07
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 44 220 4.0E-07
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 43 213 6.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 158 229 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|679
MLITTLLALSFPLLSLAHPLNLSPLRTSLSPSSIIIEQDPLPRWSDYNAPSPYLTIHPATIADVQTTIRWADEQD
LPFIVYGAGNDWANSSFTHGFYLALDLLSSISFTPDRTEASIQAGALTSDVIRAGYAASSLILTATCDCVSFLGA
LLGGGVGHLTGEYGLLVDTLLSIDVVLADGSLRTVTEETEPELWWALRGAGASFGVVVGVRVRAYPEAGLWAWRG
SLVYSQGQLTPVLDVLNELELSPRAAVSLLYANRNDTPAIVIDVFYHGSASEATAFFHPLLSLRPISDTTSIKAW
PEWNEPSSAACTKGGRKPTWGVGLARFNAAVFARVFQVWLELTGQPFARKSSMLLNWVSMDKARAVPLGDSAVPF
RDAVALFATFTVAYEDAGFDDEALRYGRLVRGLWRGADGLERPLTWVLC*
Coding >Ophun1|679
ATGCTCATCACCACCCTCCTCGCCCTCTCCTTTCCCCTCCTCTCTCTCGCCCATCCCCTCAACCTCTCCCCCCTA
CGCACATCCCTCTCCCCCTCAAGCATCATCATCGAGCAAGACCCTCTCCCCCGCTGGAGCGACTACAACGCTCCA
TCCCCTTACCTCACCATCCACCCCGCCACCATCGCCGACGTGCAGACAACCATCCGCTGGGCGGATGAACAGGAC
CTTCCCTTCATCGTCTACGGCGCTGGCAATGACTGGGCAAACTCGTCCTTTACTCATGGCTTCTACCTCGCCCTC
GACCTCCTCTCCTCCATCTCCTTCACCCCGGACCGCACTGAAGCCTCCATCCAAGCCGGCGCCTTGACCTCCGAC
GTCATCCGCGCCGGCTACGCTGCCTCCTCCCTCATCTTGACCGCTACATGCGACTGCGTGTCCTTCCTCGGCGCC
CTGCTAGGCGGCGGCGTGGGACACCTCACGGGCGAGTACGGCCTGCTGGTCGACACGCTGCTGTCCATCGACGTC
GTTCTGGCTGACGGGTCGCTCCGGACGGTGACGGAGGAGACGGAGCCGGAGCTGTGGTGGGCCCTTCGCGGGGCG
GGGGCCAGCTTCGGCGTCGTCGTCGGCGTTCGGGTCCGGGCTTATCCGGAGGCTGGGCTTTGGGCTTGGAGGGGG
AGTCTGGTGTACTCTCAGGGGCAGCTTACTCCGGTGCTTGATGTTCTCAACGAGTTGGAGTTGTCGCCTCGAGCA
GCGGTGAGCCTCCTCTACGCAAACCGCAATGATACGCCTGCCATCGTCATCGACGTCTTCTACCACGGCTCCGCA
TCCGAAGCCACCGCCTTCTTCCACCCGCTCCTCTCCCTAAGACCAATCTCAGACACAACTTCCATCAAAGCCTGG
CCGGAGTGGAACGAGCCCTCGTCCGCAGCGTGCACCAAGGGAGGGAGGAAACCTACCTGGGGCGTTGGCCTCGCG
CGCTTCAACGCAGCCGTCTTCGCCCGCGTCTTCCAAGTCTGGCTCGAGCTTACGGGACAGCCCTTTGCGAGGAAG
AGTTCGATGCTGCTGAACTGGGTGTCCATGGACAAGGCCAGGGCTGTGCCGCTGGGGGATTCGGCGGTTCCGTTT
CGGGATGCTGTCGCTTTGTTTGCTACCTTTACGGTTGCGTACGAGGACGCGGGGTTTGATGACGAGGCTTTGCGG
TATGGGCGGTTGGTTAGGGGGTTGTGGAGGGGGGCGGATGGGTTGGAGAGGCCTTTGACGTGGGTTCTCTGTTGA
Transcript >Ophun1|679
ATGCTCATCACCACCCTCCTCGCCCTCTCCTTTCCCCTCCTCTCTCTCGCCCATCCCCTCAACCTCTCCCCCCTA
CGCACATCCCTCTCCCCCTCAAGCATCATCATCGAGCAAGACCCTCTCCCCCGCTGGAGCGACTACAACGCTCCA
TCCCCTTACCTCACCATCCACCCCGCCACCATCGCCGACGTGCAGACAACCATCCGCTGGGCGGATGAACAGGAC
CTTCCCTTCATCGTCTACGGCGCTGGCAATGACTGGGCAAACTCGTCCTTTACTCATGGCTTCTACCTCGCCCTC
GACCTCCTCTCCTCCATCTCCTTCACCCCGGACCGCACTGAAGCCTCCATCCAAGCCGGCGCCTTGACCTCCGAC
GTCATCCGCGCCGGCTACGCTGCCTCCTCCCTCATCTTGACCGCTACATGCGACTGCGTGTCCTTCCTCGGCGCC
CTGCTAGGCGGCGGCGTGGGACACCTCACGGGCGAGTACGGCCTGCTGGTCGACACGCTGCTGTCCATCGACGTC
GTTCTGGCTGACGGGTCGCTCCGGACGGTGACGGAGGAGACGGAGCCGGAGCTGTGGTGGGCCCTTCGCGGGGCG
GGGGCCAGCTTCGGCGTCGTCGTCGGCGTTCGGGTCCGGGCTTATCCGGAGGCTGGGCTTTGGGCTTGGAGGGGG
AGTCTGGTGTACTCTCAGGGGCAGCTTACTCCGGTGCTTGATGTTCTCAACGAGTTGGAGTTGTCGCCTCGAGCA
GCGGTGAGCCTCCTCTACGCAAACCGCAATGATACGCCTGCCATCGTCATCGACGTCTTCTACCACGGCTCCGCA
TCCGAAGCCACCGCCTTCTTCCACCCGCTCCTCTCCCTAAGACCAATCTCAGACACAACTTCCATCAAAGCCTGG
CCGGAGTGGAACGAGCCCTCGTCCGCAGCGTGCACCAAGGGAGGGAGGAAACCTACCTGGGGCGTTGGCCTCGCG
CGCTTCAACGCAGCCGTCTTCGCCCGCGTCTTCCAAGTCTGGCTCGAGCTTACGGGACAGCCCTTTGCGAGGAAG
AGTTCGATGCTGCTGAACTGGGTGTCCATGGACAAGGCCAGGGCTGTGCCGCTGGGGGATTCGGCGGTTCCGTTT
CGGGATGCTGTCGCTTTGTTTGCTACCTTTACGGTTGCGTACGAGGACGCGGGGTTTGATGACGAGGCTTTGCGG
TATGGGCGGTTGGTTAGGGGGTTGTGGAGGGGGGCGGATGGGTTGGAGAGGCCTTTGACGTGGGTTCTCTGTTGA
Gene >Ophun1|679
ATGCTCATCACCACCCTCCTCGCCCTCTCCTTTCCCCTCCTCTCTCTCGCCCATCCCCTCAACCTCTCCCCCCTA
CGCACATCCCTCTCCCCCTCAAGCATCATCATCGAGCAAGACCCTCTCCCCCGCTGGAGCGACTACAACGCTCCA
TCCCCTTACCTCACCATCCACCCCGCCACCATCGCCGACGTGCAGACAACCGTAAGCCCCGTCCCCGAAAGCCGC
CCACCTGCTTACCTCTCATCCCCTCCCCACAGATCCGCTGGGCGGATGAACAGGACCTTCCCTTCATCGTCTACG
GCGCTGGCAATGACTGGGCAAACTCGTCCTTTACTCATGGCTTCTACCTCGCCCTCGACCTCCTCTCCTCCATCT
CCTTCACCCCGGACCGCACTGAAGCCTCCATCCAAGCCGGCGCCTTGACCTCCGACGTCATCCGCGCCGGCTACG
CTGCCTCCTCCCTCATCTTGACCGCTACATGCGACTGCGTGTCCTTCCTCGGCGCCCTGCTAGGCGGCGGCGTGG
GACACCTCACGGGCGAGTACGGCCTGCTGGTCGACACGCTGCTGTCCATCGACGTCGTTCTGGCTGACGGGTCGC
TCCGGACGGTGACGGAGGAGACGGAGCCGGAGCTGTGGTGGGCCCTTCGCGGGGCGGGGGCCAGCTTCGGCGTCG
TCGTCGGCGTTCGGGTCCGGGCTTATCCGGAGGCTGGGCTTTGGGCTTGGAGGGGGAGTCTGGTGTACTCTCAGG
GGCAGCTTACTCCGGTGCTTGATGTTCTCAACGAGTTGGAGTTGTCGCCTCGAGCAGCGGTGAGCCTCCTCTACG
CAAACCGCAATGATACGCCTGCCATCGTCATCGACGTCTTCTACCACGGCTCCGCATCCGAAGCCACCGCCTTCT
TCCACCCGCTCCTCTCCCTAAGACCAATCTCAGACACAACTTCCATCAAAGCCTGGCCGGAGTGGAACGAGCCCT
CGTCCGCAGCGTGCACCAAGGGAGGGAGGAAACCTACCTGGGGCGTTGGCCTCGCGCGCTTCAACGCAGCCGTCT
TCGCCCGCGTCTTCCAAGTCTGGCTCGAGCTTACGGGACAGCCCTTTGCGAGGAAGAGTTCGATGCTGCTGAACT
GGGTGTCCATGGACAAGGCCAGGGCTGTGCCGCTGGGGGATTCGGCGGTTCCGTTTCGGGATGCTGTCGCTTTGT
TTGCTACCTTTACGGTTGCGTACGAGGACGCGGGGTTTGATGACGAGGCTTTGCGGTATGGGCGGTTGGTTAGGG
GGTTGTGGAGGGGGGCGGATGGGTTGGAGAGGCCTTTGACGTGGGTTCTCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail