Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6788
Gene name
LocationContig_775:5105..7583
Strand+
Gene length (bp)2478
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08385 DHC_N1 Dynein heavy chain, N-terminal region 1 6.3E-104 265 786

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78716|DYHC_FUSSO Dynein heavy chain, cytoplasmic OS=Fusarium solani subsp. pisi GN=DHC1 PE=3 SV=1 1 786 0.0E+00
sp|P45443|DYHC_NEUCR Dynein heavy chain, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-1 PE=3 SV=1 10 786 0.0E+00
sp|P45444|DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudA PE=3 SV=2 1 786 0.0E+00
sp|P38650|DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus GN=Dync1h1 PE=1 SV=1 116 786 7.0E-173
sp|Q9JHU4|DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus GN=Dync1h1 PE=1 SV=2 116 786 1.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78716|DYHC_FUSSO Dynein heavy chain, cytoplasmic OS=Fusarium solani subsp. pisi GN=DHC1 PE=3 SV=1 1 786 0.0E+00
sp|P45443|DYHC_NEUCR Dynein heavy chain, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-1 PE=3 SV=1 10 786 0.0E+00
sp|P45444|DYHC_EMENI Dynein heavy chain, cytoplasmic OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudA PE=3 SV=2 1 786 0.0E+00
sp|P38650|DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus GN=Dync1h1 PE=1 SV=1 116 786 7.0E-173
sp|Q9JHU4|DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus GN=Dync1h1 PE=1 SV=2 116 786 1.0E-172
sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 116 786 1.0E-171
sp|P37276|DYHC_DROME Dynein heavy chain, cytoplasmic OS=Drosophila melanogaster GN=Dhc64C PE=2 SV=2 66 778 2.0E-162
sp|P34036|DYHC_DICDI Dynein heavy chain, cytoplasmic OS=Dictyostelium discoideum GN=dhcA PE=1 SV=2 159 786 3.0E-138
sp|Q19020|DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorhabditis elegans GN=dhc-1 PE=1 SV=1 65 778 5.0E-123
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162 OS=Plasmodium falciparum (isolate 3D7) GN=MAL7P1.162 PE=2 SV=2 206 778 8.0E-109
sp|Q9C1M7|DYHC_ASHGO Dynein heavy chain, cytoplasmic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DYN1 PE=3 SV=1 117 787 2.0E-100
sp|Q27171|DYHC_PARTE Dynein heavy chain, cytoplasmic OS=Paramecium tetraurelia GN=DHC-8 PE=2 SV=1 22 778 5.0E-87
sp|O13290|DYHC_SCHPO Dynein heavy chain, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhc1 PE=1 SV=1 201 787 3.0E-68
sp|P36022|DYHC_YEAST Dynein heavy chain, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DYN1 PE=1 SV=1 115 787 2.0E-36
sp|Q27802|DYHC2_TRIGR Cytoplasmic dynein 2 heavy chain 1 OS=Tripneustes gratilla GN=DYH1B PE=2 SV=2 361 778 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6788
MEVSSSAPPSNGVASPTFPTVEPERVVDHLAAVCEIALGATRLQLEQPGNLLHKSRYAETISRCTRFANDAQSVL
YVQKDVAPSSATENGAESAVPASFYYTLSTELSASASTVASLVLLKSPQPIDPTRPLTSQIFITNLPGPASLNAA
VGEHGASLSPWEVLHSQVHHALVPYFDANTRSQQAANGARGRTEVDAKTGIPVTKKRLNDLELSLLHLQQNVDIP
DISLTFHSIVQNVVEEAEARHTRPSLDSIPANLLQDSTFLNRLQANVNTWIKSIQGITKMTKDPSPGANQEFSTA
SQEVNFWLSMESALESIEGQLRSEGVLLTLEILKHAKRFQATVSFTADTGLKEAMEKVQKYNQLMRDFPLDELLS
ATSLPKVQEAIAQIFGHLNKKLRICPYPVRRALPLVEAISADLDDVLRRLLPGTELVDLDYQEFQALMRTCDGIF
RVWEDNIKEFTNVAREVTRRRNEKFIPIKIIRKHSELESRIKYVGTFRDNHEQLQRTIVNVLGPGIKTAGGGGSD
VPTAAAGTSNGVVMEDMGGVDAVMEVKQAWEALQHVDLLDVTDQGKERWVRAENLYNERTTRVENSIIARLRDRL
ATAKTANEMFRVFSKFNALFVRPKIRGAIQEYQNQLMDHVKQAINGLHERFKMQYGHSEAHAMAQLRDLPPVSGA
IIWARQIEFQLDGYMRKVEAVLGPDWHLHAEGHKLREESDLFKRKLNTARIFEAWLADVGRRKISIAGQLFDIAR
VRAAGGILELAVNFDPQVITLFKETRNLVWQSGCIPTPSA*
Coding >Ophun1|6788
ATGGAGGTATCATCCTCTGCGCCGCCGTCAAATGGCGTCGCGTCGCCGACTTTCCCCACTGTCGAGCCAGAACGC
GTCGTCGACCATCTGGCGGCTGTCTGCGAGATCGCCCTAGGAGCCACGAGGCTTCAGCTCGAACAGCCGGGTAAC
CTGCTGCACAAGAGCCGCTACGCAGAGACCATCTCGCGATGCACTCGCTTTGCCAACGATGCTCAGAGCGTTCTC
TACGTTCAGAAGGATGTTGCGCCCTCTTCGGCGACTGAGAATGGCGCCGAGTCTGCTGTCCCTGCCAGCTTCTAC
TACACTCTCTCGACTGAGTTGTCTGCATCGGCTTCGACCGTTGCTTCGCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTGACGTCGCAAATCTTCATCACCAACCTGCCGGGCCCCGCCTCGCTCAACGCCGCT
GTGGGCGAGCATGGGGCATCTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCAAATACCCGGAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGGACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGTCTGCTTCACCTACAGCAGAACGTCGACATCCCC
GATATTTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGACCTTCG
CTCGACTCCATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTCTGGCTCTCGATGGAGTCGGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTCCTCACACTCGAGATTCTCAAGCACGCCAAGCGTTTCCAGGCCACCGTCAGCTTCACTGCCGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAATACAACCAGCTGATGCGCGACTTTCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATTGCGCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTATCCCGTCAGGCGGGCGCTCCCCTTGGTGGAGGCCATCTCGGCCGATCTGGACGATGTGCTCCGTCGGCTG
TTGCCGGGCACCGAGCTCGTCGACCTCGATTACCAAGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGACAACATCAAGGAGTTTACCAACGTTGCGCGCGAGGTGACGCGTCGTCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTCGAGTCTCGTATCAAGTACGTCGGCACCTTCCGCGACAAC
CACGAGCAGCTCCAGCGGACCATCGTCAACGTCCTGGGCCCCGGCATCAAGACGGCCGGCGGTGGCGGCTCCGAC
GTCCCCACGGCTGCCGCGGGCACCTCAAACGGCGTCGTCATGGAAGACATGGGCGGCGTCGACGCCGTCATGGAG
GTCAAGCAGGCTTGGGAGGCGCTGCAGCACGTCGACTTGCTCGACGTTACCGACCAGGGCAAAGAACGATGGGTT
CGGGCTGAGAACCTGTACAACGAGCGGACGACGCGGGTGGAAAACTCCATTATTGCCCGGCTGCGAGACCGGCTT
GCGACGGCCAAGACGGCCAACGAGATGTTTCGCGTCTTTTCCAAGTTCAACGCGCTCTTTGTGCGGCCCAAGATC
AGGGGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCCTGCACGAGCGC
TTCAAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGATCTGCCGCCCGTCTCGGGAGCC
ATCATCTGGGCGCGCCAGATCGAGTTTCAGCTCGACGGCTACATGAGAAAGGTTGAGGCCGTCCTCGGCCCGGAC
TGGCATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACTTGTTCAAGCGCAAGCTTAACACGGCCCGT
ATCTTCGAGGCCTGGCTGGCCGACGTCGGCCGGCGCAAAATCTCCATCGCCGGCCAGCTCTTCGACATTGCCCGG
GTCAGGGCTGCCGGTGGGATCCTCGAGCTGGCCGTCAACTTTGATCCGCAGGTCATTACGCTCTTCAAGGAGACG
AGGAACCTCGTGTGGCAGTCCGGGTGTATCCCTACGCCGTCAGCTTGA
Transcript >Ophun1|6788
ATGGAGGTATCATCCTCTGCGCCGCCGTCAAATGGCGTCGCGTCGCCGACTTTCCCCACTGTCGAGCCAGAACGC
GTCGTCGACCATCTGGCGGCTGTCTGCGAGATCGCCCTAGGAGCCACGAGGCTTCAGCTCGAACAGCCGGGTAAC
CTGCTGCACAAGAGCCGCTACGCAGAGACCATCTCGCGATGCACTCGCTTTGCCAACGATGCTCAGAGCGTTCTC
TACGTTCAGAAGGATGTTGCGCCCTCTTCGGCGACTGAGAATGGCGCCGAGTCTGCTGTCCCTGCCAGCTTCTAC
TACACTCTCTCGACTGAGTTGTCTGCATCGGCTTCGACCGTTGCTTCGCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTGACGTCGCAAATCTTCATCACCAACCTGCCGGGCCCCGCCTCGCTCAACGCCGCT
GTGGGCGAGCATGGGGCATCTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCAAATACCCGGAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGGACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGTCTGCTTCACCTACAGCAGAACGTCGACATCCCC
GATATTTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGACCTTCG
CTCGACTCCATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTCTGGCTCTCGATGGAGTCGGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTCCTCACACTCGAGATTCTCAAGCACGCCAAGCGTTTCCAGGCCACCGTCAGCTTCACTGCCGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAATACAACCAGCTGATGCGCGACTTTCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATTGCGCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTATCCCGTCAGGCGGGCGCTCCCCTTGGTGGAGGCCATCTCGGCCGATCTGGACGATGTGCTCCGTCGGCTG
TTGCCGGGCACCGAGCTCGTCGACCTCGATTACCAAGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGACAACATCAAGGAGTTTACCAACGTTGCGCGCGAGGTGACGCGTCGTCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTCGAGTCTCGTATCAAGTACGTCGGCACCTTCCGCGACAAC
CACGAGCAGCTCCAGCGGACCATCGTCAACGTCCTGGGCCCCGGCATCAAGACGGCCGGCGGTGGCGGCTCCGAC
GTCCCCACGGCTGCCGCGGGCACCTCAAACGGCGTCGTCATGGAAGACATGGGCGGCGTCGACGCCGTCATGGAG
GTCAAGCAGGCTTGGGAGGCGCTGCAGCACGTCGACTTGCTCGACGTTACCGACCAGGGCAAAGAACGATGGGTT
CGGGCTGAGAACCTGTACAACGAGCGGACGACGCGGGTGGAAAACTCCATTATTGCCCGGCTGCGAGACCGGCTT
GCGACGGCCAAGACGGCCAACGAGATGTTTCGCGTCTTTTCCAAGTTCAACGCGCTCTTTGTGCGGCCCAAGATC
AGGGGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCCTGCACGAGCGC
TTCAAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGATCTGCCGCCCGTCTCGGGAGCC
ATCATCTGGGCGCGCCAGATCGAGTTTCAGCTCGACGGCTACATGAGAAAGGTTGAGGCCGTCCTCGGCCCGGAC
TGGCATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACTTGTTCAAGCGCAAGCTTAACACGGCCCGT
ATCTTCGAGGCCTGGCTGGCCGACGTCGGCCGGCGCAAAATCTCCATCGCCGGCCAGCTCTTCGACATTGCCCGG
GTCAGGGCTGCCGGTGGGATCCTCGAGCTGGCCGTCAACTTTGATCCGCAGGTCATTACGCTCTTCAAGGAGACG
AGGAACCTCGTGTGGCAGTCCGGGTGTATCCCTACGCCGTCAGCTTGA
Gene >Ophun1|6788
ATGGAGGTATCATCCTCTGCGCCGCCGTCAAATGGCGTCGCGTCGCCGACTTTCCCCACTGTCGAGCCAGAACGC
GTCGTCGACCATCTGGCGGCTGTCTGCGAGATCGCCCTAGGAGCCACGAGGCTTCAGCTCGAACAGCCGGGTAAC
CTGCTGCACAAGAGCCGCTACGCAGAGACCATCTCGCGATGCACTCGCTTTGCCAACGATGCTCAGAGCGTTCTC
TACGTTCAGAAGGATGTTGCGCCCTCTTCGGCGACTGAGAATGGCGCCGAGTCTGCTGGTCAGTTTCCCCCCCTT
TCATGATCTCCCTCTTTTGACTCGTCGCTGAACGCCTCTTAGTCCCTGCCAGCTTCTACTACACTCTCTCGACTG
AGTTGTCTGCATCGGCTTCGACCGTTGCTTCGCTCGTCCTGCTCAAGTCGCCGCAGCCCATCGATCCCACCCGTC
CGCTGACGTCGCAAATCTTCATCACCAACCTGCCGGGCCCCGCCTCGCTCAACGCCGCTGTGGGCGAGCATGGGG
CATCTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTACTTCGACGCAAATACCC
GGAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGGACCGAGGTCGACGCCAAGACGGGCATCCCCGTCACCAAGA
AGAGGCTCAACGACTTGGAGCTCAGTCTGCTTCACCTACAGCAGAACGTCGACATCCCCGATATTTCCCTGACCT
TTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGACCTTCGCTCGACTCCATACCCG
CCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGGATCAAGTCCATCCAGG
GCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCCAGTCAAGAGGTCAATT
TCTGGCTCTCGATGGAGTCGGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGCGTCCTCCTCACACTCG
AGATTCTCAAGCACGCCAAGCGTTTCCAGGCCACCGTCAGCTTCACTGCCGACACGGGCCTCAAGGAGGCCATGG
AAAAGGTGCAGAAATACAACCAGCTGATGCGCGACTTTCCCCTCGACGAGCTCCTCTCCGCCACGTCGCTGCCCA
AGGTCCAGGAGGCTATTGCGCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGCCCCTATCCCGTCAGGC
GGGCGCTCCCCTTGGTGGAGGCCATCTCGGCCGATCTGGACGATGTGCTCCGTCGGCTGTTGCCGGGCACCGAGC
TCGTCGACCTCGATTACCAAGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTTAGGGTGTGGGAGGACA
ACATCAAGGAGTTTACCAACGTTGCGCGCGAGGTGACGCGTCGTCGGAACGAAAAGTTCATACCCATCAAGATCA
TCAGGAAGCACTCGGAGCTCGAGTCTCGTATCAAGTACGTCGGCACCTTCCGCGACAACCACGAGCAGCTCCAGC
GGACCATCGTCAACGTCCTGGGCCCCGGCATCAAGACGGCCGGCGGTGGCGGCTCCGACGTCCCCACGGCTGCCG
CGGGCACCTCAAACGGCGTCGTCATGGAAGACATGGGCGGCGTCGACGCCGTCATGGAGGTCAAGCAGGCTTGGG
AGGCGCTGCAGCACGTCGACTTGCTCGACGTTACCGACCAGGGCAAAGAACGATGGGTTCGGGCTGAGAACCTGT
ACAACGAGCGGACGACGCGGGTGGAAAACTCCATTATTGCCCGGCTGCGAGACCGGCTTGCGACGGCCAAGACGG
CCAACGAGATGTTTCGCGTCTTTTCCAAGTTCAACGCGCTCTTTGTGCGGCCCAAGATCAGGGGCGCCATACAGG
AGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCCTGCACGAGCGCTTCAAGATGCAGTACG
GTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGATCTGCCGCCCGTCTCGGGAGCCATCATCTGGGCGCGCC
AGATCGAGTTTCAGCTCGACGGCTACATGAGAAAGGTTGAGGCCGTCCTCGGCCCGGACTGGCATCTGCACGCCG
AGGGACACAAGCTGCGCGAGGAGAGCGACTTGTTCAAGCGCAAGCTTAACACGGCCCGTATCTTCGAGGCCTGGC
TGGCCGACGTCGGCCGGCGCAAAATCTCCATCGCCGGCCAGCTCTTCGACATTGCCCGGGTCAGGGCTGCCGGTG
GGATCCTCGAGCTGGCCGTCAACTTTGATCCGCAGGTCATTACGCTCTTCAAGGAGACGAGGAACCTCGTGTGGC
AGTCGTATTCCGTTCCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCCTACGCCGTCAGCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail