Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6782
Gene name
LocationContig_773:5949..6948
Strand+
Gene length (bp)999
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12311 DUF3632 Protein of unknown function (DUF3632) 1.4E-23 59 259

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6200
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02430
Ophiocordyceps camponoti-rufipedis Ophun1|6782 (this protein)
Ophiocordyceps kimflemingae Ophio5|3620
Ophiocordyceps kimflemingae Ophio5|7213
Ophiocordyceps subramaniannii Hirsu2|6183

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6782
MADACATGSLTRQEKRQEYQSDPVKASSVRNSLRQDLLRIGQEFFNGEDDFEETVRDVWDELIHTACILPPDSAE
TDRLVTLVLEIRELGPLVRKGGDGDDQLAVMPNRQRFWSDLPYLLDELCESWAADASVPALESRASQTHSGHESP
TAVRRARLAALTGKLCAVGVLPEDLSGFALCLFRDALEVEAADEARLLPACFEFLSSAHLILARLCAANHEPAAY
EKRGDVRPGALAVQAGVDGSGFSIRRWLFWRRRFGELYVGGGPLAKLARKCFEVMVDTGLALGIDIPGEKKYLER
VFQALDKEVEALDAEVCVSADGIRIDPAWAED*
Coding >Ophun1|6782
ATGGCCGACGCTTGCGCTACGGGAAGCCTCACGCGGCAGGAGAAGCGGCAGGAATACCAAAGTGACCCGGTCAAG
GCATCTTCTGTGCGCAACAGCCTCCGTCAGGATCTTCTACGCATCGGCCAGGAGTTCTTCAACGGCGAGGATGAC
TTTGAGGAGACGGTGCGCGATGTCTGGGACGAGCTCATCCACACGGCCTGCATCCTACCGCCCGACAGCGCCGAG
ACGGACCGGCTCGTGACGCTCGTGCTTGAGATACGCGAGCTTGGCCCGCTCGTCCGCAAGGGCGGCGACGGCGAT
GACCAGCTGGCCGTCATGCCAAACCGCCAGCGGTTCTGGTCTGATCTACCCTACCTTTTAGACGAGCTGTGCGAG
TCGTGGGCGGCCGACGCCTCGGTGCCGGCTCTGGAGTCGCGGGCCAGCCAGACTCATTCCGGCCATGAGAGCCCG
ACGGCTGTTCGGCGGGCCAGGCTGGCGGCGCTGACGGGCAAGCTCTGCGCCGTCGGTGTCCTGCCTGAGGACCTT
TCCGGCTTTGCCCTCTGCCTGTTCCGCGACGCACTCGAGGTCGAGGCCGCCGATGAGGCGCGTCTGCTGCCCGCA
TGCTTCGAGTTCCTGAGCAGCGCCCACCTGATACTGGCCAGGCTGTGCGCCGCCAACCACGAGCCGGCGGCCTAC
GAGAAGCGAGGGGATGTGCGTCCCGGTGCGCTGGCGGTACAGGCGGGCGTCGACGGGTCGGGATTCAGCATCCGT
CGTTGGCTGTTCTGGAGGAGGCGCTTTGGGGAGCTGTACGTTGGCGGTGGACCCCTGGCCAAGCTGGCGAGGAAG
TGCTTCGAGGTCATGGTCGACACGGGACTTGCCCTGGGCATCGACATTCCCGGGGAGAAGAAGTATCTGGAGAGG
GTGTTTCAGGCGCTGGACAAGGAGGTGGAGGCGTTGGATGCCGAGGTGTGCGTGTCGGCTGATGGGATCCGCATT
GACCCGGCCTGGGCCGAAGACTGA
Transcript >Ophun1|6782
ATGGCCGACGCTTGCGCTACGGGAAGCCTCACGCGGCAGGAGAAGCGGCAGGAATACCAAAGTGACCCGGTCAAG
GCATCTTCTGTGCGCAACAGCCTCCGTCAGGATCTTCTACGCATCGGCCAGGAGTTCTTCAACGGCGAGGATGAC
TTTGAGGAGACGGTGCGCGATGTCTGGGACGAGCTCATCCACACGGCCTGCATCCTACCGCCCGACAGCGCCGAG
ACGGACCGGCTCGTGACGCTCGTGCTTGAGATACGCGAGCTTGGCCCGCTCGTCCGCAAGGGCGGCGACGGCGAT
GACCAGCTGGCCGTCATGCCAAACCGCCAGCGGTTCTGGTCTGATCTACCCTACCTTTTAGACGAGCTGTGCGAG
TCGTGGGCGGCCGACGCCTCGGTGCCGGCTCTGGAGTCGCGGGCCAGCCAGACTCATTCCGGCCATGAGAGCCCG
ACGGCTGTTCGGCGGGCCAGGCTGGCGGCGCTGACGGGCAAGCTCTGCGCCGTCGGTGTCCTGCCTGAGGACCTT
TCCGGCTTTGCCCTCTGCCTGTTCCGCGACGCACTCGAGGTCGAGGCCGCCGATGAGGCGCGTCTGCTGCCCGCA
TGCTTCGAGTTCCTGAGCAGCGCCCACCTGATACTGGCCAGGCTGTGCGCCGCCAACCACGAGCCGGCGGCCTAC
GAGAAGCGAGGGGATGTGCGTCCCGGTGCGCTGGCGGTACAGGCGGGCGTCGACGGGTCGGGATTCAGCATCCGT
CGTTGGCTGTTCTGGAGGAGGCGCTTTGGGGAGCTGTACGTTGGCGGTGGACCCCTGGCCAAGCTGGCGAGGAAG
TGCTTCGAGGTCATGGTCGACACGGGACTTGCCCTGGGCATCGACATTCCCGGGGAGAAGAAGTATCTGGAGAGG
GTGTTTCAGGCGCTGGACAAGGAGGTGGAGGCGTTGGATGCCGAGGTGTGCGTGTCGGCTGATGGGATCCGCATT
GACCCGGCCTGGGCCGAAGACTGA
Gene >Ophun1|6782
ATGGCCGACGCTTGCGCTACGGGAAGCCTCACGCGGCAGGAGAAGCGGCAGGAATACCAAAGTGACCCGGTCAAG
GCATCTTCTGTGCGCAACAGCCTCCGTCAGGATCTTCTACGCATCGGCCAGGAGTTCTTCAACGGCGAGGATGAC
TTTGAGGAGACGGTGCGCGATGTCTGGGACGAGCTCATCCACACGGCCTGCATCCTACCGCCCGACAGCGCCGAG
ACGGACCGGCTCGTGACGCTCGTGCTTGAGATACGCGAGCTTGGCCCGCTCGTCCGCAAGGGCGGCGACGGCGAT
GACCAGCTGGCCGTCATGCCAAACCGCCAGCGGTTCTGGTCTGATCTACCCTACCTTTTAGACGAGCTGTGCGAG
TCGTGGGCGGCCGACGCCTCGGTGCCGGCTCTGGAGTCGCGGGCCAGCCAGACTCATTCCGGCCATGAGAGCCCG
ACGGCTGTTCGGCGGGCCAGGCTGGCGGCGCTGACGGGCAAGCTCTGCGCCGTCGGTGTCCTGCCTGAGGACCTT
TCCGGCTTTGCCCTCTGCCTGTTCCGCGACGCACTCGAGGTCGAGGCCGCCGATGAGGCGCGTCTGCTGCCCGCA
TGCTTCGAGTTCCTGAGCAGCGCCCACCTGATACTGGCCAGGCTGTGCGCCGCCAACCACGAGCCGGCGGCCTAC
GAGAAGCGAGGGGATGTGCGTCCCGGTGCGCTGGCGGTACAGGCGGGCGTCGACGGGTCGGGATTCAGCATCCGT
CGTTGGCTGTTCTGGAGGAGGCGCTTTGGGGAGCTGTACGTTGGCGGTGGACCCCTGGCCAAGCTGGCGAGGAAG
TGCTTCGAGGTCATGGTCGACACGGGACTTGCCCTGGGCATCGACATTCCCGGGGAGAAGAAGTATCTGGAGAGG
GTGTTTCAGGCGCTGGACAAGGAGGTGGAGGCGTTGGATGCCGAGGTGTGCGTGTCGGCTGATGGGATCCGCATT
GACCCGGCCTGGGCCGAAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail