Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6781
Gene name
LocationContig_773:3200..5485
Strand+
Gene length (bp)2285
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.5E-155 54 703

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 32 744 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 33 744 3.0E-170
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 31 715 6.0E-144
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 13 744 7.0E-144
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 16 714 2.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 32 744 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 33 744 3.0E-170
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 31 715 6.0E-144
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 13 744 7.0E-144
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 16 714 2.0E-143
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 27 715 2.0E-136
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 28 738 9.0E-135
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 14 715 1.0E-133
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 33 714 1.0E-133
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 35 734 2.0E-133
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 27 715 8.0E-131
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 38 715 1.0E-126
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 12 740 6.0E-106
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 20 731 2.0E-105
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 83 105 22
3 162 184 22
4 188 210 22
5 226 248 22
6 268 290 22
7 302 324 22
8 373 395 22
9 424 446 22
10 450 467 17
11 472 494 22
12 536 558 22
13 604 626 22
14 646 668 22
15 681 703 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6781
MGEELPVKTNAVEPEAAIKLDALDEPDSPIEQEDSPYEEVRAAVRNSDEGEVANTLRAWIIGLFFVTLGTGLHMF
LSMRSPAISLPAIVVQLLAYPIGCLWARLVPDRVFTIFGRRWSLNPGPFTIKEHVVISLMSNVSIGGAYSTDALV
AMRARPFFNLDFGWGFALLFTLSSQLVGIALAGLFRNFLVLPAAMIWSRQFASCALFYALHDKRPTPGCRISRYR
WFAAVAAAMFCYSWLPAVVWRGLSVFAFVTWIRPRSPVVNQLFGGFSGLSLLPLTLDWTYVTAYLGDPLLAPTTS
HLNTLVGLLLFVVVGSVVMVFTGALHSDYLPVVSANTYDNRQRLYDATRVLGPGQTFDEHRYRRYSPLFLPPALA
LNYGLSFAALTSALVHMWLHQRRDLWHRLRQQQLPDVHTKLMARYVDAPGWWYGALLVFSLGLSLATALGYDSQL
PWWALLVSIGLAVIFIVPVTTVLAVYNIMLGLNVLAPFLAGFILPGRPVGVAMFNVYSTVVLLQAQTYSGDLKLG
HYMKVPPRITFWCQVVATVWAVFVQVAVMNWTLGHVNGVCENMQPDHFSCPNGRAFFSATVVWGLVGPRRLFGVG
GMYAHLNWFWLLGAALPLLLYRLARLPAMQFVSRLRAPVMLGAMAWLPPGTPLSYSTWAIVGLVFNGWIRKRWKA
WWMTYNYTTAAALDSGLILATVVVFFAITWPGRELRWWGNVAVFDTLDARHAATLKTVPEGGAFGPSTW*
Coding >Ophun1|6781
ATGGGCGAGGAATTGCCTGTCAAGACCAACGCCGTCGAGCCGGAGGCGGCCATCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCCCATCGAGCAAGAAGACTCGCCGTACGAAGAAGTGCGCGCCGCTGTGCGCAACTCGGATGAAGGC
GAGGTAGCCAACACGCTGAGGGCATGGATCATCGGCCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTT
CTCTCCATGAGGAGTCCTGCCATCAGCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTATCCCATTGGCTGCCTC
TGGGCCAGACTCGTTCCCGATCGCGTCTTCACCATCTTCGGCCGGCGCTGGAGCCTCAACCCCGGGCCCTTCACC
ATTAAGGAGCATGTAGTCATATCGCTCATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACTGACGCTCTCGTC
GCCATGCGCGCCCGACCCTTCTTCAACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCTCAG
CTCGTCGGCATCGCTCTGGCCGGCCTCTTCCGCAACTTTCTCGTTCTGCCGGCCGCCATGATCTGGTCTCGTCAG
TTCGCCAGCTGCGCTCTCTTCTACGCCCTTCACGATAAGAGGCCGACGCCCGGCTGTCGCATCAGCCGCTATCGC
TGGTTCGCCGCCGTGGCTGCCGCCATGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCTTGTCCGTC
TTTGCCTTTGTCACCTGGATCCGGCCTCGGAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCG
CTGCTCCCCTTGACCCTCGACTGGACCTATGTCACTGCCTACCTCGGCGACCCTCTGCTGGCCCCGACGACGTCG
CACCTAAACACGCTCGTCGGCCTGCTTCTCTTCGTCGTCGTCGGATCCGTTGTCATGGTCTTTACAGGCGCCCTG
CACTCCGACTATCTGCCCGTCGTCTCGGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTG
CTGGGCCCCGGTCAGACGTTTGACGAGCATCGCTATCGCCGCTACTCGCCACTCTTCCTGCCGCCTGCTCTCGCC
CTCAACTACGGTCTGTCGTTTGCCGCTCTGACGTCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGATCTC
TGGCACCGCCTCCGCCAGCAGCAGCTGCCCGACGTGCACACCAAGCTGATGGCTCGCTACGTCGACGCCCCCGGC
TGGTGGTACGGTGCCCTACTGGTCTTCTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGACTCGCAGCTG
CCGTGGTGGGCTCTGCTGGTCTCTATCGGCCTCGCTGTTATCTTCATCGTTCCCGTCACCACCGTCTTGGCCGTC
TACAACATCATGCTCGGTCTCAACGTCCTCGCCCCCTTTCTTGCAGGCTTCATCCTGCCCGGACGGCCCGTAGGC
GTCGCCATGTTCAACGTCTACAGTACCGTCGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAGCTGGGT
CATTACATGAAGGTGCCCCCTCGCATCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAG
GTGGCCGTCATGAACTGGACACTCGGTCACGTCAACGGCGTCTGCGAGAACATGCAGCCGGACCACTTCTCATGC
CCCAATGGACGCGCCTTTTTCTCCGCCACCGTCGTTTGGGGCCTCGTCGGTCCGCGCCGCTTGTTTGGCGTCGGG
GGCATGTACGCCCATCTCAACTGGTTCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTACCGTCTCGCTCGG
CTCCCGGCCATGCAGTTTGTGAGCCGACTGCGGGCGCCCGTCATGCTGGGTGCCATGGCGTGGCTGCCTCCGGGG
ACGCCCCTGAGTTACTCAACGTGGGCCATCGTCGGCCTCGTCTTCAACGGCTGGATCCGCAAGAGGTGGAAGGCG
TGGTGGATGACGTACAACTACACGACGGCCGCCGCACTCGACTCGGGCCTGATTCTGGCCACCGTCGTCGTCTTC
TTCGCTATCACTTGGCCGGGCCGAGAGCTGCGTTGGTGGGGGAACGTGGCCGTCTTTGACACGCTCGATGCCCGG
CACGCGGCTACCCTCAAGACGGTGCCCGAGGGGGGGGCGTTTGGGCCTTCGACGTGGTGA
Transcript >Ophun1|6781
ATGGGCGAGGAATTGCCTGTCAAGACCAACGCCGTCGAGCCGGAGGCGGCCATCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCCCATCGAGCAAGAAGACTCGCCGTACGAAGAAGTGCGCGCCGCTGTGCGCAACTCGGATGAAGGC
GAGGTAGCCAACACGCTGAGGGCATGGATCATCGGCCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTT
CTCTCCATGAGGAGTCCTGCCATCAGCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTATCCCATTGGCTGCCTC
TGGGCCAGACTCGTTCCCGATCGCGTCTTCACCATCTTCGGCCGGCGCTGGAGCCTCAACCCCGGGCCCTTCACC
ATTAAGGAGCATGTAGTCATATCGCTCATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACTGACGCTCTCGTC
GCCATGCGCGCCCGACCCTTCTTCAACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCTCAG
CTCGTCGGCATCGCTCTGGCCGGCCTCTTCCGCAACTTTCTCGTTCTGCCGGCCGCCATGATCTGGTCTCGTCAG
TTCGCCAGCTGCGCTCTCTTCTACGCCCTTCACGATAAGAGGCCGACGCCCGGCTGTCGCATCAGCCGCTATCGC
TGGTTCGCCGCCGTGGCTGCCGCCATGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCTTGTCCGTC
TTTGCCTTTGTCACCTGGATCCGGCCTCGGAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCG
CTGCTCCCCTTGACCCTCGACTGGACCTATGTCACTGCCTACCTCGGCGACCCTCTGCTGGCCCCGACGACGTCG
CACCTAAACACGCTCGTCGGCCTGCTTCTCTTCGTCGTCGTCGGATCCGTTGTCATGGTCTTTACAGGCGCCCTG
CACTCCGACTATCTGCCCGTCGTCTCGGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTG
CTGGGCCCCGGTCAGACGTTTGACGAGCATCGCTATCGCCGCTACTCGCCACTCTTCCTGCCGCCTGCTCTCGCC
CTCAACTACGGTCTGTCGTTTGCCGCTCTGACGTCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGATCTC
TGGCACCGCCTCCGCCAGCAGCAGCTGCCCGACGTGCACACCAAGCTGATGGCTCGCTACGTCGACGCCCCCGGC
TGGTGGTACGGTGCCCTACTGGTCTTCTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGACTCGCAGCTG
CCGTGGTGGGCTCTGCTGGTCTCTATCGGCCTCGCTGTTATCTTCATCGTTCCCGTCACCACCGTCTTGGCCGTC
TACAACATCATGCTCGGTCTCAACGTCCTCGCCCCCTTTCTTGCAGGCTTCATCCTGCCCGGACGGCCCGTAGGC
GTCGCCATGTTCAACGTCTACAGTACCGTCGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAGCTGGGT
CATTACATGAAGGTGCCCCCTCGCATCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAG
GTGGCCGTCATGAACTGGACACTCGGTCACGTCAACGGCGTCTGCGAGAACATGCAGCCGGACCACTTCTCATGC
CCCAATGGACGCGCCTTTTTCTCCGCCACCGTCGTTTGGGGCCTCGTCGGTCCGCGCCGCTTGTTTGGCGTCGGG
GGCATGTACGCCCATCTCAACTGGTTCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTACCGTCTCGCTCGG
CTCCCGGCCATGCAGTTTGTGAGCCGACTGCGGGCGCCCGTCATGCTGGGTGCCATGGCGTGGCTGCCTCCGGGG
ACGCCCCTGAGTTACTCAACGTGGGCCATCGTCGGCCTCGTCTTCAACGGCTGGATCCGCAAGAGGTGGAAGGCG
TGGTGGATGACGTACAACTACACGACGGCCGCCGCACTCGACTCGGGCCTGATTCTGGCCACCGTCGTCGTCTTC
TTCGCTATCACTTGGCCGGGCCGAGAGCTGCGTTGGTGGGGGAACGTGGCCGTCTTTGACACGCTCGATGCCCGG
CACGCGGCTACCCTCAAGACGGTGCCCGAGGGGGGGGCGTTTGGGCCTTCGACGTGGTGA
Gene >Ophun1|6781
ATGGGCGAGGAATTGCCTGTCAAGACCAACGCCGTCGAGCCGGAGGCGGCCATCAAGCTCGATGCCCTTGACGAA
CCAGACTCGCCCATCGAGCAAGAAGACTCGCCGTACGAAGAAGTGCGCGCCGCTGTGCGCAACTCGGATGAAGGC
GAGGTAGCCAACACGCTGAGGGCATGGATCATCGGCCTGTTCTTCGTCACTCTCGGCACCGGCCTTCACATGTTT
CTCTCCATGAGGTGAGCGTCTCGTTCCTGACGCATCAGCCCAGACGCTCATTCTGTCCAAGGAGTCCTGCCATCA
GCCTGCCGGCCATCGTCGTCCAGCTTCTCGCGTATCCCATTGGCTGCCTCTGGGCCAGACTCGTTCCCGATCGCG
TCTTCACCATCTTCGGCCGGCGCTGGAGCCTCAACCCCGGGCCCTTCACCATTAAGGAGCATGTAGTCATATCGC
TCATGTCCAACGTCTCCATCGGCGGCGCTTATAGCACTGACGCTCTCGTCGCCATGCGCGCCCGACCCTTCTTCA
ACCTCGACTTTGGCTGGGGCTTCGCCTTGCTCTTCACCCTCAGCTCTCAGCTCGTCGGCATCGCTCTGGCCGGCC
TCTTCCGCAACTTTCTCGTTCTGCCGGCCGCCATGATCTGGTCTCGTCAGTTCGCCAGCTGCGCTCTCTTCTACG
CCCTTCACGATAAGAGGCCGACGCCCGGCTGTCGCATCAGCCGCTATCGCTGGTTCGCCGCCGTGGCTGCCGCCA
TGTTCTGCTACTCATGGCTGCCGGCCGTCGTGTGGCGTGGCTTGTCCGTCTTTGCCTTTGTCACCTGGATCCGGC
CTCGGAGCCCCGTCGTCAACCAGCTCTTTGGCGGTTTCTCCGGCCTCTCGCTGCTCCCCTTGACCCTCGACTGGA
CCTATGTCACTGCCTACCTCGGCGACCCTCTGCTGGCCCCGACGACGTCGCACCTAAACACGCTCGTCGGCCTGC
TTCTCTTCGTCGTCGTCGGATCCGTTGTCATGGTCTTTACAGGCGCCCTGCACTCCGACTATCTGCCCGTCGTCT
CGGCCAACACGTACGACAACCGCCAGCGCCTATACGACGCCACCCGCGTGCTGGGCCCCGGTCAGACGTTTGACG
AGCATCGCTATCGCCGCTACTCGCCACTCTTCCTGCCGCCTGCTCTCGCCCTCAACTACGGTCTGTCGTTTGCCG
CTCTGACGTCGGCCCTCGTTCACATGTGGCTGCATCAGCGCCGCGATCTCTGGCACCGCCTCCGCCAGCAGCAGC
TGCCCGACGTGCACACCAAGCTGATGGCTCGCTACGTCGACGCCCCCGGCTGGTGGTACGGTGCCCTACTGGTCT
TCTCGCTCGGCCTCAGCCTGGCCACGGCGCTGGGCTACGACTCGCAGCTGCCGTGGTGGGCTCTGCTGGTCTCTA
TCGGCCTCGCTGTTATCTTCATCGTTCCCGTCACCACCGTCTTGGCCGTCTACAACATCATGCTCGGTCTCAACG
TCCTCGCCCCCTTTCTTGCAGGCTTCATCCTGCCCGGACGGCCCGTAGGCGTCGCCATGTTCAACGTCTACAGTA
CCGTCGTCCTCTTGCAAGCCCAGACGTACAGCGGCGATCTCAAGCTGGGTCATTACATGAAGGTGCCCCCTCGCA
TCACCTTTTGGTGCCAGGTCGTGGCCACGGTCTGGGCCGTCTTCGTTCAGGTGGCCGTCATGAACTGGACACTCG
GTCACGTCAACGGCGTCTGCGAGAACATGCAGCCGGACCACTTCTCATGCCCCAATGGACGCGCCTTTTTCTCCG
CCACCGTCGTTTGGGGCCTCGTCGGTCCGCGCCGCTTGTTTGGCGTCGGGGGCATGTACGCCCATCTCAACTGGT
TCTGGCTCCTCGGCGCCGCCCTGCCGCTGCTTCTGTACCGTCTCGCTCGGCTCCCGGCCATGCAGTTTGTGAGCC
GACTGCGGGCGCCCGTCATGCTGGGTGCCATGGCGTGGCTGCCTCCGGGGACGCCCCTGAGTTACTCAACGTGGG
CCATCGTCGGCCTCGTCTTCAACGGCTGGATCCGCAAGAGGTGGAAGGCGTGGTGGATGACGTACAACTACACGA
CGGCCGCCGCACTCGACTCGGGCCTGATTCTGGCCACCGTCGTCGTCTTCTTCGCTATCACTTGGCCGGGCCGAG
AGCTGCGTTGGTGGGGGAACGTGGCCGTCTTTGACACGCTCGATGCCCGGCACGCGGCTACCCTCAAGACGGTGC
CCGAGGGGGGGGCGTTTGGGCCTTCGACGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail