Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6777
Gene name
LocationContig_771:392..2235
Strand-
Gene length (bp)1843
Transcript length (bp)1773
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-16 76 494
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.2E-07 125 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 13 589 2.0E-142
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 20 586 1.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 24 552 3.0E-88
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 39 577 5.0E-73
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 13 554 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 13 589 2.0E-142
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 20 586 1.0E-102
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 24 552 3.0E-88
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 39 577 5.0E-73
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 13 554 1.0E-66
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 31 584 2.0E-56
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 22 574 5.0E-46
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 2 562 2.0E-45
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 20 588 4.0E-44
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 4 582 2.0E-41
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 96 561 1.0E-40
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 96 561 2.0E-40
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 19 519 8.0E-11
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 10 338 4.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 125 548 2.0E-06
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 123 338 3.0E-06
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 76 410 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 106 125 19
3 137 154 17
4 164 183 19
5 196 218 22
6 228 250 22
7 280 302 22
8 307 329 22
9 348 370 22
10 385 407 22
11 416 435 19
12 450 472 22
13 479 501 22
14 555 574 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6777
MGTKTARHLFGRAAEEPPPSKEADTKTDSPSAEDPGSVSGPDAEAISPDAQSGVQDAEAMTKAWTKTSLIVAYIL
IWLIYFVDSLQQGVTGALHPFVTSAFQQHSLTAATGVMSNLMGGLLKLPLAKVLDLWGRPQGFAITTVLLTLGLA
MMAGCKTVETYAAAQVFYWVGFNGMGYSLSVFIADTSALENRGLMLAFLYSPFIITAWTGGPIATNVLAGIGWRW
FFGIFAILTPAVSLPLIVLFAYNLFKAKKLGLMPARGPRRGLLAATRHYLIELDIVGLLLITGGLALFLLPFSIY
TYQAAQWRSPLIICMLVFGVVLLICFVLYEKLLAPVQFIPYRLLVDRTILGAMVSATMTFIAFFLWDSYLLSLLQ
VVNNLSLTDATYIIKIFTVGSCFSGLIVGVLIRWTGRYKWLALYFGVPLTILGVGLMMHFGQPHHPIGYVVMCQV
LIALAGGAITICEQTAVLAVISHQHAAVVLAVLSMCSSVGGAIGSTLSAAIWTTLLPRKLEELLPAEAQSNRTVI
YNDLMAQLSYPMGSPVREAISEAYSETQKMMIIPALVALFVALGAVFAWRDVHVKDSKQTKGTVV*
Coding >Ophun1|6777
ATGGGCACCAAGACAGCCCGTCACCTCTTCGGCCGCGCAGCCGAAGAACCCCCTCCGTCCAAGGAAGCCGACACA
AAGACCGACAGTCCCTCGGCCGAAGACCCCGGCTCCGTCTCCGGCCCCGATGCCGAGGCCATCTCTCCCGATGCC
CAGTCCGGCGTGCAGGACGCAGAGGCCATGACCAAGGCCTGGACCAAGACATCGCTGATTGTGGCATACATCTTG
ATCTGGCTCATCTACTTTGTCGACTCGCTGCAACAGGGCGTAACCGGGGCCCTTCATCCCTTCGTCACCAGCGCC
TTTCAACAGCATTCCCTTACGGCGGCAACGGGCGTCATGTCCAATCTCATGGGTGGCCTATTGAAGCTACCGCTC
GCAAAGGTTCTCGACCTCTGGGGCCGGCCTCAGGGCTTCGCCATCACCACGGTACTTCTCACCCTCGGCCTCGCC
ATGATGGCAGGTTGCAAGACGGTCGAGACGTATGCCGCTGCCCAGGTCTTTTACTGGGTTGGGTTTAATGGCATG
GGCTACAGTCTCTCCGTCTTCATCGCCGACACGTCCGCGCTCGAGAACCGCGGCCTCATGCTGGCTTTCCTCTAC
TCGCCCTTCATCATCACCGCCTGGACCGGCGGCCCCATCGCTACCAACGTCCTGGCCGGTATCGGCTGGCGCTGG
TTCTTTGGCATCTTCGCCATCCTCACCCCCGCCGTCTCCCTACCCCTGATCGTCCTCTTCGCCTACAACCTCTTC
AAGGCCAAGAAACTAGGCCTTATGCCTGCTCGCGGGCCCCGACGCGGCCTCCTGGCGGCGACTCGTCATTATCTG
ATCGAACTGGACATCGTCGGCCTGCTGCTCATCACCGGCGGTCTCGCCCTCTTCCTGCTACCCTTTAGCATCTAC
ACGTACCAGGCAGCCCAGTGGCGGTCACCCCTAATCATCTGCATGCTCGTCTTCGGCGTCGTCCTGCTCATCTGC
TTCGTCCTATACGAGAAGCTCCTCGCGCCGGTGCAGTTCATCCCTTACCGGCTGCTGGTTGACCGCACCATCCTC
GGCGCCATGGTGTCGGCCACCATGACTTTCATCGCCTTCTTCCTATGGGATAGCTACCTACTATCGCTACTTCAG
GTTGTCAACAACTTGTCACTGACGGACGCGACGTACATCATCAAGATCTTTACCGTCGGCAGCTGCTTCTCAGGC
CTCATCGTCGGAGTCCTGATTCGATGGACGGGCCGGTACAAATGGCTGGCGCTCTACTTCGGCGTACCTCTCACC
ATCCTCGGCGTCGGCCTCATGATGCACTTCGGCCAGCCTCACCACCCAATTGGCTACGTCGTCATGTGCCAAGTC
TTGATCGCCCTCGCCGGCGGAGCCATCACCATCTGCGAGCAAACCGCCGTCTTGGCAGTCATCTCCCACCAGCAC
GCCGCCGTCGTCCTCGCCGTGCTATCCATGTGCTCGTCAGTCGGCGGCGCCATCGGCAGCACGCTTTCAGCCGCC
ATCTGGACCACGCTTCTTCCCCGGAAGCTGGAGGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACCGTCATC
TACAACGACCTGATGGCCCAGCTGTCGTACCCCATGGGGTCGCCCGTGCGCGAGGCCATCAGCGAGGCCTACAGC
GAGACGCAGAAGATGATGATTATCCCTGCGCTTGTCGCCTTGTTCGTCGCGCTGGGGGCTGTCTTTGCCTGGCGG
GACGTTCACGTCAAGGATTCGAAGCAGACCAAGGGGACGGTCGTATAG
Transcript >Ophun1|6777
ATGGGCACCAAGACAGCCCGTCACCTCTTCGGCCGCGCAGCCGAAGAACCCCCTCCGTCCAAGGAAGCCGACACA
AAGACCGACAGTCCCTCGGCCGAAGACCCCGGCTCCGTCTCCGGCCCCGATGCCGAGGCCATCTCTCCCGATGCC
CAGTCCGGCGTGCAGGACGCAGAGGCCATGACCAAGGCCTGGACCAAGACATCGCTGATTGTGGCATACATCTTG
ATCTGGCTCATCTACTTTGTCGACTCGCTGCAACAGGGCGTAACCGGGGCCCTTCATCCCTTCGTCACCAGCGCC
TTTCAACAGCATTCCCTTACGGCGGCAACGGGCGTCATGTCCAATCTCATGGGTGGCCTATTGAAGCTACCGCTC
GCAAAGGTTCTCGACCTCTGGGGCCGGCCTCAGGGCTTCGCCATCACCACGGTACTTCTCACCCTCGGCCTCGCC
ATGATGGCAGGTTGCAAGACGGTCGAGACGTATGCCGCTGCCCAGGTCTTTTACTGGGTTGGGTTTAATGGCATG
GGCTACAGTCTCTCCGTCTTCATCGCCGACACGTCCGCGCTCGAGAACCGCGGCCTCATGCTGGCTTTCCTCTAC
TCGCCCTTCATCATCACCGCCTGGACCGGCGGCCCCATCGCTACCAACGTCCTGGCCGGTATCGGCTGGCGCTGG
TTCTTTGGCATCTTCGCCATCCTCACCCCCGCCGTCTCCCTACCCCTGATCGTCCTCTTCGCCTACAACCTCTTC
AAGGCCAAGAAACTAGGCCTTATGCCTGCTCGCGGGCCCCGACGCGGCCTCCTGGCGGCGACTCGTCATTATCTG
ATCGAACTGGACATCGTCGGCCTGCTGCTCATCACCGGCGGTCTCGCCCTCTTCCTGCTACCCTTTAGCATCTAC
ACGTACCAGGCAGCCCAGTGGCGGTCACCCCTAATCATCTGCATGCTCGTCTTCGGCGTCGTCCTGCTCATCTGC
TTCGTCCTATACGAGAAGCTCCTCGCGCCGGTGCAGTTCATCCCTTACCGGCTGCTGGTTGACCGCACCATCCTC
GGCGCCATGGTGTCGGCCACCATGACTTTCATCGCCTTCTTCCTATGGGATAGCTACCTACTATCGCTACTTCAG
GTTGTCAACAACTTGTCACTGACGGACGCGACGTACATCATCAAGATCTTTACCGTCGGCAGCTGCTTCTCAGGC
CTCATCGTCGGAGTCCTGATTCGATGGACGGGCCGGTACAAATGGCTGGCGCTCTACTTCGGCGTACCTCTCACC
ATCCTCGGCGTCGGCCTCATGATGCACTTCGGCCAGCCTCACCACCCAATTGGCTACGTCGTCATGTGCCAAGTC
TTGATCGCCCTCGCCGGCGGAGCCATCACCATCTGCGAGCAAACCGCCGTCTTGGCAGTCATCTCCCACCAGCAC
GCCGCCGTCGTCCTCGCCGTGCTATCCATGTGCTCGTCAGTCGGCGGCGCCATCGGCAGCACGCTTTCAGCCGCC
ATCTGGACCACGCTTCTTCCCCGGAAGCTGGAGGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACCGTCATC
TACAACGACCTGATGGCCCAGCTGTCGTACCCCATGGGGTCGCCCGTGCGCGAGGCCATCAGCGAGGCCTACAGC
GAGACGCAGAAGATGATGATTATCCCTGCGCTTGTCGCCTTGTTCGTCGCGCTGGGGGCTGTCTTTGCCTGGCGG
GACGTTCACGTCAAGGATTCGAAGCAGACCAAGGGGACGGTCGTATAG
Gene >Ophun1|6777
ATGGGCACCAAGACAGCCCGTCACCTCTTCGGCCGCGCAGCCGAAGAACCCCCTCCGTCCAAGGAAGCCGACACA
AAGACCGACAGTCCCTCGGCCGAAGACCCCGGCTCCGTCTCCGGCCCCGATGCCGAGGCCATCTCTCCCGATGCC
CAGTCCGGCGTGCAGGACGCAGAGGCCATGACCAAGGCCTGGACCAAGACATCGCTGATTGTGGCATACATCTTG
ATCTGGCTCATCTACTTTGTCGACTCGCTGCAACAGGGCGTAACCGGGGCCCTTCATCCCTTCGTCACCAGCGCC
TTTCAACAGCATTCCCTTACGGCGGCAACGGGCGTCATGTCCAATCTCATGGGTGGCCTATTGAAGCTACCGCTC
GCAAAGGTTCTCGACCTCTGGGGCCGGCCTCAGGGCTTCGCCATCACCACGGTACTTCTCACCCTCGGCCTCGCC
ATGATGGCAGGTTGCAAGACGGTCGAGACGTATGCCGCTGCCCAGGTCTTTTACTGGGTTGGGTGAGTCGTCCCA
TCGTCATGGCATCTCTCGAAAGCCGAAGCTGACAACGAGACTGATTGTGCATGGCAGGTTTAATGGCATGGGCTA
CAGTCTCTCCGTCTTCATCGCCGACACGTCCGCGCTCGAGAACCGCGGCCTCATGCTGGCTTTCCTCTACTCGCC
CTTCATCATCACCGCCTGGACCGGCGGCCCCATCGCTACCAACGTCCTGGCCGGTATCGGCTGGCGCTGGTTCTT
TGGCATCTTCGCCATCCTCACCCCCGCCGTCTCCCTACCCCTGATCGTCCTCTTCGCCTACAACCTCTTCAAGGC
CAAGAAACTAGGCCTTATGCCTGCTCGCGGGCCCCGACGCGGCCTCCTGGCGGCGACTCGTCATTATCTGATCGA
ACTGGACATCGTCGGCCTGCTGCTCATCACCGGCGGTCTCGCCCTCTTCCTGCTACCCTTTAGCATCTACACGTA
CCAGGCAGCCCAGTGGCGGTCACCCCTAATCATCTGCATGCTCGTCTTCGGCGTCGTCCTGCTCATCTGCTTCGT
CCTATACGAGAAGCTCCTCGCGCCGGTGCAGTTCATCCCTTACCGGCTGCTGGTTGACCGCACCATCCTCGGCGC
CATGGTGTCGGCCACCATGACTTTCATCGCCTTCTTCCTATGGGATAGCTACCTACTATCGCTACTTCAGGTTGT
CAACAACTTGTCACTGACGGACGCGACGTACATCATCAAGATCTTTACCGTCGGCAGCTGCTTCTCAGGCCTCAT
CGTCGGAGTCCTGATTCGATGGACGGGCCGGTACAAATGGCTGGCGCTCTACTTCGGCGTACCTCTCACCATCCT
CGGCGTCGGCCTCATGATGCACTTCGGCCAGCCTCACCACCCAATTGGCTACGTCGTCATGTGCCAAGTCTTGAT
CGCCCTCGCCGGCGGAGCCATCACCATCTGCGAGCAAACCGCCGTCTTGGCAGTCATCTCCCACCAGCACGCCGC
CGTCGTCCTCGCCGTGCTATCCATGTGCTCGTCAGTCGGCGGCGCCATCGGCAGCACGCTTTCAGCCGCCATCTG
GACCACGCTTCTTCCCCGGAAGCTGGAGGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACCGTCATCTACAA
CGACCTGATGGCCCAGCTGTCGTACCCCATGGGGTCGCCCGTGCGCGAGGCCATCAGCGAGGCCTACAGCGAGAC
GCAGAAGATGATGATTATCCCTGCGCTTGTCGCCTTGTTCGTCGCGCTGGGGGCTGTCTTTGCCTGGCGGGACGT
TCACGTCAAGGATTCGAAGCAGACCAAGGGGACGGTCGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail