Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6775
Gene name
LocationContig_770:4700..5704
Strand+
Gene length (bp)1004
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 6.1E-25 28 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 12 180 1.0E-15
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 11 183 5.0E-15
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 16 180 2.0E-12
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 16 180 3.0E-12
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 16 180 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 12 180 1.0E-15
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 11 183 5.0E-15
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 16 180 2.0E-12
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 16 180 3.0E-12
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 16 180 3.0E-12
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 32 170 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6775
MAPSQLPQTRAMLMGILALCLFLWPAVVHLPDSRSPEEIKKDGGFLPARPPQSDEAFSLYRHALRHAEMESAYSD
DCIYISTTRKFQLAAQEIKRQGEGWVYIIYPSPNMFDQAKSLSNHDPSPGSETVVAVGGIHWSQVMAWVHISPRK
KDQAFASNPDFDRSWLALPLTRPQPQLAGFCDGRKGCGAHLREKVDAFMDVVGAERSGWIEVARVNISS*
Coding >Ophun1|6775
ATGGCACCCTCTCAGCTCCCCCAGACTCGAGCCATGCTCATGGGCATTCTCGCCCTCTGTCTGTTTCTCTGGCCC
GCCGTCGTTCACCTACCTGATAGCCGCAGTCCAGAGGAGATCAAGAAGGACGGCGGTTTCCTACCTGCCAGGCCG
CCCCAGTCGGACGAGGCCTTTAGCCTCTACCGTCACGCCCTTCGTCATGCCGAGATGGAGTCAGCATACAGCGAC
GACTGCATCTACATCTCAACAACACGCAAGTTCCAACTCGCCGCCCAAGAAATCAAGAGACAAGGCGAAGGCTGG
GTCTACATAATCTACCCATCCCCCAACATGTTCGACCAAGCCAAGTCCCTCAGCAACCACGACCCCTCCCCCGGG
AGCGAGACCGTCGTGGCAGTGGGCGGCATCCACTGGAGCCAGGTCATGGCCTGGGTGCACATCTCCCCGCGCAAG
AAGGACCAGGCCTTCGCCTCGAACCCGGACTTTGACCGCTCGTGGCTGGCTTTGCCGCTGACGAGGCCGCAGCCT
CAGCTTGCGGGCTTCTGCGATGGGAGGAAGGGGTGTGGCGCGCATCTGAGGGAGAAGGTTGATGCGTTTATGGAT
GTTGTTGGAGCGGAGCGCTCAGGATGGATTGAAGTGGCGAGGGTAAATATCTCCAGCTAG
Transcript >Ophun1|6775
ATGGCACCCTCTCAGCTCCCCCAGACTCGAGCCATGCTCATGGGCATTCTCGCCCTCTGTCTGTTTCTCTGGCCC
GCCGTCGTTCACCTACCTGATAGCCGCAGTCCAGAGGAGATCAAGAAGGACGGCGGTTTCCTACCTGCCAGGCCG
CCCCAGTCGGACGAGGCCTTTAGCCTCTACCGTCACGCCCTTCGTCATGCCGAGATGGAGTCAGCATACAGCGAC
GACTGCATCTACATCTCAACAACACGCAAGTTCCAACTCGCCGCCCAAGAAATCAAGAGACAAGGCGAAGGCTGG
GTCTACATAATCTACCCATCCCCCAACATGTTCGACCAAGCCAAGTCCCTCAGCAACCACGACCCCTCCCCCGGG
AGCGAGACCGTCGTGGCAGTGGGCGGCATCCACTGGAGCCAGGTCATGGCCTGGGTGCACATCTCCCCGCGCAAG
AAGGACCAGGCCTTCGCCTCGAACCCGGACTTTGACCGCTCGTGGCTGGCTTTGCCGCTGACGAGGCCGCAGCCT
CAGCTTGCGGGCTTCTGCGATGGGAGGAAGGGGTGTGGCGCGCATCTGAGGGAGAAGGTTGATGCGTTTATGGAT
GTTGTTGGAGCGGAGCGCTCAGGATGGATTGAAGTGGCGAGGGTAAATATCTCCAGCTAG
Gene >Ophun1|6775
ATGGCACCCTCTCAGCTCCCCCAGACTCGAGCCATGCTCATGGGCATTCTCGCCCTCTGTCTGTTTCTCTGGCCC
GTGAGCAGCCAGACGCTCCCTCACTCCCGAGAACCGGCAACCCGGCCGCCTCTCATCCGACGCGGTACAGCCTCG
ACTCAGGCGTCGCCATCCAACCTACAAAGCGCCGCTCACGCTATTTCTCGGACTCGCCCGCCCGCCATCCGACCT
CGTCGCGTCCCATTGGGAAACTGGCAGGCCGTCGTTCACCTACCTGATAGCCGCAGTCCAGAGGAGATCAAGAAG
GACGGCGGTTTCCTACCTGCCAGGCCGCCCCAGTCGGACGAGGCCTTTAGCCTCTACCGTCACGCCCTTCGTCAT
GCCGAGATGGAGTCAGCATACAGCGACGACTGCATCTACATCTCAACAACACGCAAGTTCCAACTCGCCGCCCAA
GAAATCAAGAGACAAGGCGAAGGCTGGGTCTACATAATCTACCCATCCCCCAACATGTTCGACCAAGCCAAGTCC
CTCAGCAACCACGACCCCTCCCCCGGGAGCGAGACCGTCGTGGCAGTGGGCGGCATCCACTGGAGCCAGGTCATG
GCCTGGGTGCACATCTCCCCGCGCAAGAAGGACCAGGCCTTCGCCTCGAACCCGGACTTTGACCGCTCGTGGCTG
GCTTTGCCGCTGACGAGGCCGCAGCCTCAGCTTGCGGGCTTCTGCGATGGGAGGAAGGGGTGTGGCGCGCATCTG
AGGGAGAAGGTTGATGCGTTTATGGATGTTGTTGGAGCGGAGGTTGGGTGGAGGGGGGGGTGGCCTCTATTCGAG
AGGGGGGGGTTTGATGGGAGGCATAATCATTTGATCTTTTCGCCGAGGTTGGGATGAGGAAGGGGGGGTGTCTGC
TTGGTTGATGGGATGATAAGGTTGATGAGGATGGTGGTGAAGTTGCTATATCCGCACAGCGCTCAGGATGGATTG
AAGTGGCGAGGGTAAATATCTCCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail