Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6771
Gene name
LocationContig_77:39951..41765
Strand+
Gene length (bp)1814
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00463 ICL Isocitrate lyase family 1.1E-188 61 584
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 2.2E-10 142 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 15 585 0.0E+00
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 23 585 0.0E+00
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 51 584 0.0E+00
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 51 584 0.0E+00
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 49 584 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 15 585 0.0E+00
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 23 585 0.0E+00
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 51 584 0.0E+00
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 51 584 0.0E+00
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 49 584 0.0E+00
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 51 584 0.0E+00
sp|P45457|ACEA2_SOYBN Isocitrate lyase 2 (Fragment) OS=Glycine max GN=ICL2 PE=2 SV=1 58 584 8.0E-176
sp|P17069|ACEA_GOSHI Isocitrate lyase OS=Gossypium hirsutum PE=2 SV=1 53 584 4.0E-175
sp|P45456|ACEA1_SOYBN Isocitrate lyase 1 (Fragment) OS=Glycine max GN=ICL1 PE=2 SV=1 58 584 8.0E-174
sp|P15479|ACEA_RICCO Isocitrate lyase OS=Ricinus communis PE=2 SV=1 53 584 5.0E-173
sp|Q9SE26|ACEA_DENCR Isocitrate lyase OS=Dendrobium crumenatum GN=ICL PE=2 SV=1 51 584 2.0E-170
sp|Q6Z6M4|ACEA_ORYSJ Isocitrate lyase OS=Oryza sativa subsp. japonica GN=ICL PE=1 SV=1 53 584 5.0E-170
sp|P25248|ACEA_BRANA Isocitrate lyase OS=Brassica napus PE=2 SV=1 53 584 4.0E-168
sp|P93110|ACEA_CUCMA Isocitrate lyase OS=Cucurbita maxima PE=2 SV=1 53 584 2.0E-167
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 53 584 4.0E-165
sp|P49296|ACEA_CUCSA Isocitrate lyase OS=Cucumis sativus PE=3 SV=1 53 584 9.0E-164
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 53 585 4.0E-163
sp|P49297|ACEA_SOLLC Isocitrate lyase OS=Solanum lycopersicum PE=2 SV=1 53 585 1.0E-162
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 51 584 3.0E-162
sp|Q6BRY4|ACEA_DEBHA Isocitrate lyase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ICL1 PE=3 SV=1 43 584 3.0E-162
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 51 584 3.0E-162
sp|Q6T267|ACEA_ASPFU Isocitrate lyase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=icl1 PE=3 SV=2 53 584 5.0E-162
sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase OS=Leptosphaeria maculans GN=ICL1 PE=2 SV=1 52 584 6.0E-162
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 55 584 7.0E-162
sp|P28298|ACEA_EMENI Isocitrate lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuD PE=1 SV=3 53 584 9.0E-161
sp|Q9HFN2|ACEA_CYBJA Isocitrate lyase OS=Cyberlindnera jadinii GN=ICL1 PE=3 SV=1 51 584 3.0E-160
sp|Q9P8Q7|ACEA_CANAX Isocitrate lyase OS=Candida albicans GN=ICL1 PE=3 SV=1 53 584 9.0E-160
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 53 584 1.0E-159
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 51 584 7.0E-159
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 53 584 8.0E-159
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 53 584 1.0E-158
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 59 584 5.0E-158
sp|P20014|ACEA_CANTR Isocitrate lyase OS=Candida tropicalis GN=ICL1 PE=3 SV=1 53 584 2.0E-157
sp|Q96WZ5|ACEA_TALMA Isocitrate lyase OS=Talaromyces marneffei GN=icl1 PE=3 SV=1 53 584 2.0E-157
sp|Q8NJ72|ACEA_KLULA Isocitrate lyase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ICL1 PE=2 SV=1 46 584 7.0E-157
sp|P41555|ACEA_YARLI Isocitrate lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ICL1 PE=3 SV=3 52 584 2.0E-153
sp|Q9C124|ACEA_PICPA Isocitrate lyase OS=Komagataella pastoris GN=ICL1 PE=3 SV=1 53 584 2.0E-151
sp|Q9P6J1|ACEB_SCHPO Mitochondrial 2-methylisocitrate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=icl2 PE=3 SV=1 67 570 2.0E-90
sp|Q8VJU4|ACEA2_MYCTO Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl2 PE=1 SV=2 57 583 6.0E-82
sp|H8F3R6|ACEA2_MYCTE Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=aceAb PE=1 SV=1 57 583 6.0E-82
sp|Q7TZA8|ACEA2_MYCBO Isocitrate lyase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aceA PE=3 SV=1 57 583 6.0E-82
sp|P46831|ACEA_MYCLE Isocitrate lyase OS=Mycobacterium leprae (strain TN) GN=aceA PE=3 SV=2 49 540 6.0E-80
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 60 312 2.0E-52
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 60 312 2.0E-52
sp|O07718|ACEAA_MYCTU Putative isocitrate lyase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAa PE=1 SV=1 57 354 1.0E-51
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 60 312 2.0E-51
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 66 312 2.0E-43
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 72 310 2.0E-38
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 65 312 1.0E-37
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 65 312 1.0E-37
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 65 312 1.0E-37
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 65 312 1.0E-37
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 67 312 2.0E-37
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 67 316 1.0E-36
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 67 312 2.0E-36
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 410 584 5.0E-32
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 410 584 7.0E-32
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 410 584 7.0E-32
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 410 584 7.0E-32
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 410 584 1.0E-31
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 407 584 1.0E-30
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 410 584 9.0E-30
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 410 584 9.0E-30
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 410 584 9.0E-30
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 410 584 9.0E-30
sp|O07717|ACEAB_MYCTU Putative isocitrate lyase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAb PE=3 SV=1 406 583 3.0E-29
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 410 584 2.0E-26
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 403 584 9.0E-26
sp|Q9I0K4|ACEA_PSEAE Isocitrate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2634 PE=1 SV=1 133 584 2.0E-24
sp|P20699|ACEA_HELAN Isocitrate lyase (Fragment) OS=Helianthus annuus PE=2 SV=1 525 581 5.0E-12
sp|O50078|ACEA_HYPME Isocitrate lyase OS=Hyphomicrobium methylovorum GN=aceA PE=1 SV=1 204 292 1.0E-10
sp|Q9KSC2|PRPB_VIBCH 2-methylisocitrate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prpB PE=3 SV=1 118 303 3.0E-10
sp|Q9Z9T7|PRPB_BACHD 2-methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 210 329 3.0E-09
sp|D4GTL3|ACEA_HALVD Isocitrate lyase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aceA PE=1 SV=1 210 292 3.0E-09
sp|Q56062|PRPB_SALTY 2-methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpB PE=1 SV=3 109 303 5.0E-09
sp|P54528|PRPB_BACSU 2-methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 210 327 1.0E-08
sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 210 303 1.0E-08
sp|Q8EJW1|PRPB_SHEON 2-methylisocitrate lyase OS=Shewanella oneidensis (strain MR-1) GN=prpB PE=3 SV=1 109 329 1.0E-08
sp|Q937P0|PRPB_CUPNE 2-methylisocitrate lyase OS=Cupriavidus necator GN=prpB PE=1 SV=1 210 303 4.0E-08
sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 210 316 2.0E-07
sp|P77541|PRPB_ECOLI 2-methylisocitrate lyase OS=Escherichia coli (strain K12) GN=prpB PE=1 SV=3 110 303 3.0E-07
sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=2 SV=2 194 291 4.0E-07
sp|Q9YFM7|PRPB_AERPE 2-methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 210 292 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004451 isocitrate lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016833 oxo-acid-lyase activity No
GO:0016830 carbon-carbon lyase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup124
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1526
Ophiocordyceps australis 1348a (Ghana) OphauG2|919
Ophiocordyceps australis map64 (Brazil) OphauB2|2441
Ophiocordyceps australis map64 (Brazil) OphauB2|2794
Ophiocordyceps camponoti-floridani Ophcf2|00970
Ophiocordyceps camponoti-floridani Ophcf2|02425
Ophiocordyceps camponoti-rufipedis Ophun1|2676
Ophiocordyceps camponoti-rufipedis Ophun1|6771 (this protein)
Ophiocordyceps kimflemingae Ophio5|2021
Ophiocordyceps kimflemingae Ophio5|2810
Ophiocordyceps subramaniannii Hirsu2|1003
Ophiocordyceps subramaniannii Hirsu2|6391
Ophiocordyceps subramaniannii Hirsu2|7486

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6771
MTPSPTLRPSSAPRRRVSSSAPASAPHHPFSHAIPPADSFQLLPESQKTGSAEDALYEAQIKEVEAWWSSPRWAG
IRRPYQAADVVSKRGTQNISYPSSVMATKLFNLIRHRLSRGEPIHTLGAIDPVQMTQQAAHQEILYVSGWACSSV
LTTTNEVSPDFGDYPYNTVPNQVQRLAKAQSMHDRKQWDARRRMTPAERAASPYVDYLRPIVADGDTGHGGLSSV
LKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPTGEHINRLNAARFQWDVMGCENMVIARTDSESGRLLSS
AIDVRDHEFILGVSDASVEPLAEALQSMEARGASGPDMDAFEANWLAKAHLVTFDEAAVAHMQAEGVADDRIREY
RAATAGDPDMGITRRRSLAAHYARTPVYFSWDVPRTREGHYHVRAGMPMATKRALAFAPYADLLWVETGDPNVDV
ATRLARAVRDAHPAKGLVYNLSPSFNWAGHGFTPETLRSFVWDLAREGFVLQLVSLAGLHSTAAASAELARAFRT
DGMKAYVDLVQRRERDLGCDVLTHQKWSGAAYMDGILGAIQSGSSSSRSMGQGNTEGQFD*
Coding >Ophun1|6771
ATGACCCCGTCCCCCACCCTCCGGCCCTCCTCCGCCCCGCGCCGACGGGTATCATCCTCGGCCCCCGCCTCGGCA
CCGCACCATCCCTTCTCGCACGCCATCCCTCCCGCCGACTCCTTCCAGCTTCTCCCGGAGTCGCAGAAGACGGGC
TCGGCTGAGGATGCCCTGTACGAAGCTCAGATCAAGGAGGTCGAGGCCTGGTGGTCTTCGCCGCGATGGGCCGGC
ATCCGGAGACCTTACCAGGCCGCCGACGTCGTCTCCAAGCGCGGAACGCAGAATATCTCGTACCCTAGTTCCGTC
ATGGCTACCAAGCTCTTCAACCTGATCCGCCATCGTCTCTCGCGCGGCGAGCCCATCCATACCCTCGGCGCCATC
GACCCCGTGCAGATGACGCAGCAAGCAGCCCACCAAGAAATCCTCTACGTCTCCGGCTGGGCCTGCTCCTCCGTC
CTGACAACCACCAACGAGGTATCGCCCGACTTCGGCGACTACCCCTACAACACAGTCCCCAACCAAGTCCAACGT
CTCGCCAAGGCGCAGTCGATGCACGACCGCAAGCAATGGGACGCCCGTCGACGAATGACGCCCGCTGAACGAGCG
GCGAGTCCCTACGTCGATTACCTGCGGCCCATTGTTGCCGACGGCGACACGGGCCACGGAGGTCTGAGCTCCGTC
CTCAAACTGGCCAAGCTATTCGCAGAGAATGGGGCGGCGGCAGTACACTTCGAGGATCAACTTCACGGGGGCAAG
AAATGCGGTCATCTGGCGGGCAAGGTGCTGGTTCCGACGGGCGAGCACATCAACCGGCTCAACGCCGCGCGCTTC
CAATGGGACGTAATGGGATGCGAAAATATGGTCATCGCCCGCACAGACTCCGAATCAGGCCGTCTCCTATCATCC
GCCATCGACGTCCGCGACCACGAATTCATCCTAGGCGTGTCCGACGCCTCAGTCGAGCCCCTAGCCGAAGCCCTG
CAGTCCATGGAAGCCCGCGGCGCCTCGGGCCCAGACATGGACGCCTTTGAAGCAAACTGGCTGGCAAAAGCCCAT
CTCGTCACCTTTGACGAAGCAGCCGTGGCTCACATGCAAGCCGAGGGCGTCGCCGACGACCGCATCCGCGAGTAC
CGCGCCGCCACGGCCGGAGACCCGGACATGGGCATCACCCGTCGCCGGTCGCTGGCCGCTCACTACGCCCGCACG
CCCGTCTATTTCAGCTGGGATGTGCCGCGGACGCGCGAGGGCCATTATCACGTCCGCGCCGGCATGCCCATGGCC
ACCAAGCGCGCGCTGGCCTTTGCCCCCTACGCCGACCTGCTCTGGGTCGAGACGGGCGATCCCAATGTCGACGTG
GCCACCCGTCTGGCCCGAGCTGTGCGCGATGCTCATCCGGCCAAGGGTCTCGTCTATAACCTTTCGCCCTCCTTC
AACTGGGCGGGCCACGGCTTCACGCCCGAGACGCTGCGCTCCTTCGTCTGGGACCTGGCGCGAGAGGGCTTCGTC
CTGCAGCTAGTCTCGCTCGCGGGGCTGCATTCGACCGCTGCCGCCTCGGCCGAGTTGGCACGCGCTTTCCGAACT
GACGGCATGAAGGCCTATGTCGATCTGGTCCAACGACGGGAGCGGGATCTAGGGTGCGACGTTCTCACCCATCAG
AAGTGGAGCGGCGCCGCCTACATGGACGGCATCCTGGGCGCCATCCAGAGCGGGAGCTCCAGCAGTCGGAGCATG
GGACAAGGCAACACCGAGGGGCAGTTTGACTGA
Transcript >Ophun1|6771
ATGACCCCGTCCCCCACCCTCCGGCCCTCCTCCGCCCCGCGCCGACGGGTATCATCCTCGGCCCCCGCCTCGGCA
CCGCACCATCCCTTCTCGCACGCCATCCCTCCCGCCGACTCCTTCCAGCTTCTCCCGGAGTCGCAGAAGACGGGC
TCGGCTGAGGATGCCCTGTACGAAGCTCAGATCAAGGAGGTCGAGGCCTGGTGGTCTTCGCCGCGATGGGCCGGC
ATCCGGAGACCTTACCAGGCCGCCGACGTCGTCTCCAAGCGCGGAACGCAGAATATCTCGTACCCTAGTTCCGTC
ATGGCTACCAAGCTCTTCAACCTGATCCGCCATCGTCTCTCGCGCGGCGAGCCCATCCATACCCTCGGCGCCATC
GACCCCGTGCAGATGACGCAGCAAGCAGCCCACCAAGAAATCCTCTACGTCTCCGGCTGGGCCTGCTCCTCCGTC
CTGACAACCACCAACGAGGTATCGCCCGACTTCGGCGACTACCCCTACAACACAGTCCCCAACCAAGTCCAACGT
CTCGCCAAGGCGCAGTCGATGCACGACCGCAAGCAATGGGACGCCCGTCGACGAATGACGCCCGCTGAACGAGCG
GCGAGTCCCTACGTCGATTACCTGCGGCCCATTGTTGCCGACGGCGACACGGGCCACGGAGGTCTGAGCTCCGTC
CTCAAACTGGCCAAGCTATTCGCAGAGAATGGGGCGGCGGCAGTACACTTCGAGGATCAACTTCACGGGGGCAAG
AAATGCGGTCATCTGGCGGGCAAGGTGCTGGTTCCGACGGGCGAGCACATCAACCGGCTCAACGCCGCGCGCTTC
CAATGGGACGTAATGGGATGCGAAAATATGGTCATCGCCCGCACAGACTCCGAATCAGGCCGTCTCCTATCATCC
GCCATCGACGTCCGCGACCACGAATTCATCCTAGGCGTGTCCGACGCCTCAGTCGAGCCCCTAGCCGAAGCCCTG
CAGTCCATGGAAGCCCGCGGCGCCTCGGGCCCAGACATGGACGCCTTTGAAGCAAACTGGCTGGCAAAAGCCCAT
CTCGTCACCTTTGACGAAGCAGCCGTGGCTCACATGCAAGCCGAGGGCGTCGCCGACGACCGCATCCGCGAGTAC
CGCGCCGCCACGGCCGGAGACCCGGACATGGGCATCACCCGTCGCCGGTCGCTGGCCGCTCACTACGCCCGCACG
CCCGTCTATTTCAGCTGGGATGTGCCGCGGACGCGCGAGGGCCATTATCACGTCCGCGCCGGCATGCCCATGGCC
ACCAAGCGCGCGCTGGCCTTTGCCCCCTACGCCGACCTGCTCTGGGTCGAGACGGGCGATCCCAATGTCGACGTG
GCCACCCGTCTGGCCCGAGCTGTGCGCGATGCTCATCCGGCCAAGGGTCTCGTCTATAACCTTTCGCCCTCCTTC
AACTGGGCGGGCCACGGCTTCACGCCCGAGACGCTGCGCTCCTTCGTCTGGGACCTGGCGCGAGAGGGCTTCGTC
CTGCAGCTAGTCTCGCTCGCGGGGCTGCATTCGACCGCTGCCGCCTCGGCCGAGTTGGCACGCGCTTTCCGAACT
GACGGCATGAAGGCCTATGTCGATCTGGTCCAACGACGGGAGCGGGATCTAGGGTGCGACGTTCTCACCCATCAG
AAGTGGAGCGGCGCCGCCTACATGGACGGCATCCTGGGCGCCATCCAGAGCGGGAGCTCCAGCAGTCGGAGCATG
GGACAAGGCAACACCGAGGGGCAGTTTGACTGA
Gene >Ophun1|6771
ATGACCCCGTCCCCCACCCTCCGGCCCTCCTCCGCCCCGCGCCGACGGGTATCATCCTCGGCCCCCGCCTCGGCA
CCGCACCATCCCTTCTCGCACGCCATCCCTCCCGCCGACTCCTTCCAGCTTCTCCCGGAGTCGCAGAAGACGGGC
TCGGCTGAGGATGCCCTGTACGAAGCTCAGATCAAGGAGGTCGAGGCCTGGTGGTCTTCGCCGCGATGGGCCGGC
ATCCGGAGACCTTACCAGGCCGCCGACGTCGTCTCCAAGCGCGGAACGCAGAATATCTCGTACCCTAGTTCCGTC
ATGGCTACCAAGCTCTTCAACCTGATCCGCCATCGTCTCTCGCGCGGCGAGCCCATCCATACCCGTCAGTATCCC
CCGACCTTTCGCTCCAGACTCCTGACGAGTAGCTGTAAAGCAAAGTCGGCGCCATCGACCCCGTGCAGATGACGC
AGCAAGCAGCCCACCAAGAAATCCTCTACGTCTCCGGCTGGGCCTGCTCCTCCGTCCTGACAACCACCAACGAGG
TATCGCCCGACTTCGGCGACTACCCCTACAACACAGTCCCCAACCAAGTCCAACGTCTCGCCAAGGCGCAGTCGA
TGCACGACCGCAAGCAATGGGACGCCCGTCGACGAATGACGCCCGCTGAACGAGCGGCGAGTCCCTACGTCGATT
ACCTGCGGCCCATTGTTGCCGACGGCGACACGGGCCACGGAGGTCTGAGCTCCGTCCTCAAACTGGCCAAGCTAT
TCGCAGAGAATGGGGCGGCGGCAGTACACTTCGAGGATCAACTTCACGGGGGCAAGAAATGCGGTCATCTGGCGG
GCAAGGTGCTGGTTCCGACGGGCGAGCACATCAACCGGCTCAACGCCGCGCGCTTCCAATGGGACGTAATGGGAT
GCGAAAATATGGTCATCGCCCGCACAGACTCCGAATCAGGCCGTCTCCTATCATCCGCCATCGACGTCCGCGACC
ACGAATTCATCCTAGGCGTGTCCGACGCCTCAGTCGAGCCCCTAGCCGAAGCCCTGCAGTCCATGGAAGCCCGCG
GCGCCTCGGGCCCAGACATGGACGCCTTTGAAGCAAACTGGCTGGCAAAAGCCCATCTCGTCACCTTTGACGAAG
CAGCCGTGGCTCACATGCAAGCCGAGGGCGTCGCCGACGACCGCATCCGCGAGTACCGCGCCGCCACGGCCGGAG
ACCCGGACATGGGCATCACCCGTCGCCGGTCGCTGGCCGCTCACTACGCCCGCACGCCCGTCTATTTCAGCTGGG
ATGTGCCGCGGACGCGCGAGGGCCATTATCACGTCCGCGCCGGCATGCCCATGGCCACCAAGCGCGCGCTGGCCT
TTGCCCCCTACGCCGACCTGCTCTGGGTCGAGACGGGCGATCCCAATGTCGACGTGGCCACCCGTCTGGCCCGAG
CTGTGCGCGATGCTCATCCGGCCAAGGGTCTCGTCTATAACCTTTCGCCCTCCTTCAACTGGGCGGGCCACGGCT
TCACGCCCGAGACGCTGCGCTCCTTCGTCTGGGACCTGGCGCGAGAGGGCTTCGTCCTGCAGCTAGTCTCGCTCG
CGGGGCTGCATTCGACCGCTGCCGCCTCGGCCGAGTTGGCACGCGCTTTCCGAACTGACGGCATGAAGGCCTATG
TCGATCTGGTCCAACGACGGGAGCGGGATCTAGGGTGCGACGTTCTCACCCATCAGAAGTGGAGCGGCGCCGCCT
ACATGGACGGCATCCTGGGCGCCATCCAGAGCGGGAGCTCCAGCAGTCGGAGCATGGGACAAGGCAACACCGAGG
GGCAGTTTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail