Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6768
Gene name
LocationContig_77:33514..34756
Strand+
Gene length (bp)1242
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 4.1E-11 8 176
PF01494 FAD_binding_3 FAD binding domain 1.8E-07 314 351

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01911|TETX_BACFG Tetracycline resistance protein from transposon Tn4351/Tn4400 OS=Bacteroides fragilis GN=tetX PE=4 SV=1 7 390 2.0E-31
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 5 379 9.0E-08
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 114 391 5.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6768
MPGFRPRIAIAGGGPSGLALSLLLRRQGIGSTVYELRHKPRPEELAEPSGMLDLHEESGLTVMRECGLWDEFQAA
TGDCSEAMRVLRSDGVEVHADDGQSEPRPEIARHGLIRLLAEKLPGDVVRWGSKVSAVRRARNPETGAVEATVEL
GDSGSATYDLVIGADGAWSRVRALLSDTKPAYCGTQMVTATLRHATTLHPDLADLSGSGSLWALGDNKALMTQRG
SQDSIRVYAAISSPDENWAATVGLRGRTASEAKAFLLGPGGPFRNWAAPLRHLLATVCDADSQDHVGRAIDIMPM
YALPAGHLWARGDGGATLIGDAAHLMLPFAGEGVNLALWDALDLARLLAEMPAASDAMSWHKALAPRLRAMEETM
QARAKDKSEEARRNKDMILGDGAADVVAAWFKQHQSGD*
Coding >Ophun1|6768
ATGCCCGGCTTCAGGCCCCGAATCGCCATCGCGGGCGGCGGCCCCTCCGGCCTGGCCCTCTCGCTGCTCCTCCGA
CGACAGGGCATCGGCAGCACCGTGTACGAGCTGCGGCACAAGCCCCGGCCGGAGGAGCTGGCCGAACCGTCGGGC
ATGCTGGACCTGCACGAGGAGTCTGGCCTGACGGTGATGCGCGAATGCGGTCTCTGGGACGAGTTCCAGGCAGCG
ACTGGCGACTGCTCCGAGGCAATGCGCGTCTTGCGGTCGGACGGCGTCGAGGTTCACGCAGACGACGGACAGAGC
GAGCCGCGACCAGAGATTGCTCGACACGGGCTCATCCGGCTGCTGGCCGAGAAGCTTCCCGGAGACGTCGTCCGA
TGGGGCAGCAAGGTGTCGGCGGTGCGGAGGGCCCGTAATCCGGAGACGGGGGCGGTCGAGGCCACAGTCGAGCTC
GGTGACAGCGGCTCGGCGACGTACGACCTGGTCATCGGAGCCGACGGCGCCTGGTCTCGCGTCAGGGCGCTCCTC
TCGGACACGAAGCCGGCCTACTGCGGAACGCAGATGGTGACGGCGACGCTGCGACACGCAACGACCCTTCACCCG
GATCTGGCCGACCTCAGTGGCTCAGGCTCTCTCTGGGCGCTTGGCGACAACAAGGCGCTGATGACGCAGCGCGGC
TCCCAGGACTCGATCCGCGTCTATGCCGCCATCAGCTCGCCTGACGAGAACTGGGCCGCCACTGTCGGGCTCCGA
GGCCGGACGGCGAGCGAGGCAAAGGCCTTTCTGCTGGGCCCCGGTGGGCCGTTTCGCAACTGGGCTGCACCGCTG
CGACACCTGCTGGCGACGGTCTGCGACGCTGATAGCCAGGATCACGTCGGACGCGCCATCGACATCATGCCCATG
TATGCGCTTCCAGCCGGTCATCTCTGGGCCCGAGGCGATGGCGGCGCGACACTCATAGGCGACGCAGCACACCTG
ATGCTCCCCTTTGCCGGCGAGGGAGTCAATCTGGCGCTATGGGATGCTCTCGACCTCGCCCGTCTGCTGGCCGAG
ATGCCCGCTGCAAGCGACGCCATGTCCTGGCACAAGGCTCTGGCTCCTCGACTGCGAGCCATGGAGGAGACGATG
CAGGCCAGAGCCAAGGACAAGTCGGAGGAGGCGAGACGCAACAAGGACATGATTCTTGGAGACGGAGCGGCCGAT
GTGGTGGCAGCCTGGTTCAAGCAGCATCAGTCTGGAGACTGA
Transcript >Ophun1|6768
ATGCCCGGCTTCAGGCCCCGAATCGCCATCGCGGGCGGCGGCCCCTCCGGCCTGGCCCTCTCGCTGCTCCTCCGA
CGACAGGGCATCGGCAGCACCGTGTACGAGCTGCGGCACAAGCCCCGGCCGGAGGAGCTGGCCGAACCGTCGGGC
ATGCTGGACCTGCACGAGGAGTCTGGCCTGACGGTGATGCGCGAATGCGGTCTCTGGGACGAGTTCCAGGCAGCG
ACTGGCGACTGCTCCGAGGCAATGCGCGTCTTGCGGTCGGACGGCGTCGAGGTTCACGCAGACGACGGACAGAGC
GAGCCGCGACCAGAGATTGCTCGACACGGGCTCATCCGGCTGCTGGCCGAGAAGCTTCCCGGAGACGTCGTCCGA
TGGGGCAGCAAGGTGTCGGCGGTGCGGAGGGCCCGTAATCCGGAGACGGGGGCGGTCGAGGCCACAGTCGAGCTC
GGTGACAGCGGCTCGGCGACGTACGACCTGGTCATCGGAGCCGACGGCGCCTGGTCTCGCGTCAGGGCGCTCCTC
TCGGACACGAAGCCGGCCTACTGCGGAACGCAGATGGTGACGGCGACGCTGCGACACGCAACGACCCTTCACCCG
GATCTGGCCGACCTCAGTGGCTCAGGCTCTCTCTGGGCGCTTGGCGACAACAAGGCGCTGATGACGCAGCGCGGC
TCCCAGGACTCGATCCGCGTCTATGCCGCCATCAGCTCGCCTGACGAGAACTGGGCCGCCACTGTCGGGCTCCGA
GGCCGGACGGCGAGCGAGGCAAAGGCCTTTCTGCTGGGCCCCGGTGGGCCGTTTCGCAACTGGGCTGCACCGCTG
CGACACCTGCTGGCGACGGTCTGCGACGCTGATAGCCAGGATCACGTCGGACGCGCCATCGACATCATGCCCATG
TATGCGCTTCCAGCCGGTCATCTCTGGGCCCGAGGCGATGGCGGCGCGACACTCATAGGCGACGCAGCACACCTG
ATGCTCCCCTTTGCCGGCGAGGGAGTCAATCTGGCGCTATGGGATGCTCTCGACCTCGCCCGTCTGCTGGCCGAG
ATGCCCGCTGCAAGCGACGCCATGTCCTGGCACAAGGCTCTGGCTCCTCGACTGCGAGCCATGGAGGAGACGATG
CAGGCCAGAGCCAAGGACAAGTCGGAGGAGGCGAGACGCAACAAGGACATGATTCTTGGAGACGGAGCGGCCGAT
GTGGTGGCAGCCTGGTTCAAGCAGCATCAGTCTGGAGACTGA
Gene >Ophun1|6768
ATGCCCGGCTTCAGGCCCCGAATCGCCATCGCGGGCGGCGGCCCCTCCGGCCTGGCCCTCTCGCTGCTCCTCCGA
CGACAGGGCATCGGCAGCACCGTGTACGAGCTGCGGCACAAGCCCCGGCCGGAGGAGCTGGCCGAACCGTCGGGC
ATGCTGGACCTGCACGAGGAGTCTGGCCTGACGGTGATGCGCGAATGCGGTCTCTGGGACGAGTTCCAGGCAGCG
ACTGGCGACTGCTCCGAGGCAATGCGCGTCTTGCGGTCGGACGGCGTCGAGGTTCACGCAGACGACGGACAGAGC
GAGCCGCGACCAGAGATTGCTCGACACGGGCTCATCCGGCTGCTGGCCGAGAAGCTTCCCGGAGACGTCGTCCGA
TGGGGCAGCAAGGTGTCGGCGGTGCGGAGGGCCCGTAATCCGGAGACGGGGGCGGTCGAGGCCACAGTCGAGCTC
GGTGACAGCGGCTCGGCGACGTACGACCTGGTCATCGGAGCCGACGGCGCCTGGTCTCGCGTCAGGGCGCTCCTC
TCGGACACGAAGCCGGCCTACTGCGGAACGCAGATGGTGACGGCGACGCTGCGACACGCAACGACCCTTCACCCG
GATCTGGCCGACCTCAGTGGCTCAGGCTCTCTCTGGGCGCTTGGCGACAACAAGGCGCTGATGACGCAGCGCGGC
TCCCAGGACTCGATCCGCGTCTATGCCGCCATCAGCTCGCCTGACGAGAACTGGGCCGCCACTGTCGGGCTCCGA
GGCCGGACGGCGAGCGAGGCAAAGGCCTTTCTGCTGGGCCCCGGTGGGCCGTTTCGCAACTGGGCTGCACCGCTG
CGACACCTGCTGGCGACGGTCTGCGACGCTGATAGCCAGGATCACGTCGGACGCGCCATCGACATCATGCCCATG
TATGCGCTTCCAGCCGGTCATCTCTGGGCCCGAGGCGATGGCGGCGCGACACTCATAGGCGACGCAGCACACCTG
ATGCTCCCCTTTGCCGGCGAGGGAGTCAATCTGGCGCTATGGGATGCTCTCGACCTCGCCCGTCTGCTGGCCGAG
ATGCCCGCTGCAAGCGACGCCATGTCCTGGCACAAGGCTCTGGCTCCTCGACTGCGAGCCATGGAGGAGACGATG
CAGGCCAGAGCCAAGGACAAGTCGGAGGAGGCGAGACGCAACAAGGACATGATTCTTGGAGACGGAGCGGCCGAT
GTGGTGGCAGCCTGGTTCAAGCAGCATCAGTCTGGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail