Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6767
Gene name
LocationContig_77:32571..33042
Strand+
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04681 Bys1 Blastomyces yeast-phase-specific protein 1.5E-12 22 155

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B0F8|TLP1_ARTBC Antigenic thaumatin-like protein ARB_01932 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01932 PE=1 SV=2 22 156 4.0E-35
sp|D4AYB4|TLP2_ARTBC Antigenic thaumatin-like protein ARB_01183 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01183 PE=3 SV=1 23 156 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999718

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup308
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3953
Ophiocordyceps australis map64 (Brazil) OphauB2|6653
Ophiocordyceps camponoti-floridani Ophcf2|02421
Ophiocordyceps camponoti-rufipedis Ophun1|6767 (this protein)
Ophiocordyceps kimflemingae Ophio5|2814
Ophiocordyceps subramaniannii Hirsu2|11165
Ophiocordyceps subramaniannii Hirsu2|5251
Ophiocordyceps subramaniannii Hirsu2|9871

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6767
MKVNYASVVVAAGAFVPQGVTALGHARVVNKCSYAVFASSVGTNVSGPTKIDAGQVYGERFVLDRNSGGKAIKIT
KTADGLQHGEPQTILAYTLAGDTVFYDLSDVFGDGFAGSKLEVTGNAPGCRPIVWEDGTPPAGSQVKSCTSEADV
ILTLCA*
Coding >Ophun1|6767
ATGAAGGTCAACTATGCCAGCGTCGTCGTGGCCGCCGGAGCCTTCGTGCCGCAGGGAGTCACCGCCCTCGGCCAC
GCCCGCGTCGTCAACAAGTGCAGCTATGCCGTTTTCGCCTCGTCCGTCGGCACAAACGTCTCGGGTCCCACCAAG
ATCGACGCCGGACAAGTCTATGGCGAGCGCTTCGTGTTAGATCGCAACAGCGGAGGAAAGGCCATCAAGATCACA
AAGACAGCCGACGGTCTCCAACACGGAGAACCGCAGACCATACTGGCTTACACCCTCGCCGGCGATACCGTCTTC
TATGACTTGAGCGACGTCTTTGGCGATGGCTTTGCCGGCAGCAAGCTCGAGGTGACGGGCAACGCTCCCGGGTGC
CGGCCAATCGTCTGGGAGGATGGAACGCCGCCCGCGGGGAGCCAGGTCAAATCATGCACCTCGGAAGCAGATGTA
ATCCTGACGCTGTGTGCTTGA
Transcript >Ophun1|6767
ATGAAGGTCAACTATGCCAGCGTCGTCGTGGCCGCCGGAGCCTTCGTGCCGCAGGGAGTCACCGCCCTCGGCCAC
GCCCGCGTCGTCAACAAGTGCAGCTATGCCGTTTTCGCCTCGTCCGTCGGCACAAACGTCTCGGGTCCCACCAAG
ATCGACGCCGGACAAGTCTATGGCGAGCGCTTCGTGTTAGATCGCAACAGCGGAGGAAAGGCCATCAAGATCACA
AAGACAGCCGACGGTCTCCAACACGGAGAACCGCAGACCATACTGGCTTACACCCTCGCCGGCGATACCGTCTTC
TATGACTTGAGCGACGTCTTTGGCGATGGCTTTGCCGGCAGCAAGCTCGAGGTGACGGGCAACGCTCCCGGGTGC
CGGCCAATCGTCTGGGAGGATGGAACGCCGCCCGCGGGGAGCCAGGTCAAATCATGCACCTCGGAAGCAGATGTA
ATCCTGACGCTGTGTGCTTGA
Gene >Ophun1|6767
ATGAAGGTCAACTATGCCAGCGTCGTCGTGGCCGCCGGAGCCTTCGTGCCGCAGGGAGTCACCGCCCTCGGCCAC
GCCCGCGTCGTCAACAAGTGCAGCTATGCCGTTTTCGCCTCGTCCGTCGGCACAAACGTCTCGGGTCCCACCAAG
ATCGACGCCGGACAAGTCTATGGCGAGCGCTTCGTGTTAGATCGCAACAGCGGAGGAAAGGCCATCAAGATCACA
AAGACAGCCGACGGTCTCCAACACGGAGAACCGCAGACCATACTGGCTTACACCCTCGCCGGCGATACCGTCTTC
TATGACTTGAGCGACGTCTTTGGCGATGGCTTTGCCGGCAGCAAGCTCGAGGTGACGGGCAACGCTCCCGGGTGC
CGGCCAATCGTCTGGGAGGATGGAACGCCGCCCGCGGGGAGCCAGGTCAAATCATGCACCTCGGAAGCAGATGTA
ATCCTGACGCTGTGTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail