Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6761
Gene name
LocationContig_77:19813..20467
Strand-
Gene length (bp)654
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.8E-09 38 156

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999386

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7311
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02417
Ophiocordyceps camponoti-rufipedis Ophun1|6761 (this protein)
Ophiocordyceps kimflemingae Ophio5|2816

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6761
MRPAIILLAVGALAASRQSNKVSNTNSVSDAKSVSDVDTLNKALDETGAKIQSFTNAVHNWTGDALTAPGLVAEA
LEVRQSLNDLKSKVKGISKISEADLRKKGVHLIRLADPVLSLIEAATEAIGKIEGIPGARTLIYVMLQAEKESYL
DLVKALMEKMPDSVSKSGVPGSPDNLKSYTLNFAQLELEKFLKALKPAPEQSTVFDKLISQFSSYVQ*
Coding >Ophun1|6761
ATGCGGCCTGCCATCATTCTCTTGGCCGTCGGCGCCCTCGCCGCCTCTCGCCAATCGAATAAAGTCTCTAACACC
AACTCCGTCTCTGACGCCAAATCCGTCTCCGATGTCGACACGCTGAACAAGGCTTTGGACGAGACTGGCGCCAAG
ATACAGTCGTTCACCAACGCCGTCCACAACTGGACTGGAGACGCCTTGACAGCTCCGGGACTGGTGGCCGAGGCG
TTGGAAGTGCGCCAGTCACTGAATGACCTCAAATCAAAGGTGAAGGGAATCAGTAAGATCAGCGAGGCGGACCTC
AGGAAGAAGGGCGTGCATCTTATCCGGTTGGCGGATCCGGTCTTGAGCCTCATCGAGGCCGCTACCGAGGCGATC
GGCAAGATTGAAGGGATTCCCGGCGCCAGAACGTTGATCTACGTGATGCTCCAGGCGGAGAAGGAATCTTACCTC
GACCTGGTGAAAGCCCTCATGGAGAAGATGCCGGACAGTGTCTCCAAGTCTGGAGTGCCGGGCTCGCCAGACAAC
CTGAAGTCTTATACTCTGAACTTTGCCCAGCTTGAACTGGAAAAGTTTCTGAAGGCCCTGAAGCCGGCCCCTGAG
CAAAGCACTGTTTTTGATAAACTTATTTCCCAGTTTTCCTCCTATGTACAATGA
Transcript >Ophun1|6761
ATGCGGCCTGCCATCATTCTCTTGGCCGTCGGCGCCCTCGCCGCCTCTCGCCAATCGAATAAAGTCTCTAACACC
AACTCCGTCTCTGACGCCAAATCCGTCTCCGATGTCGACACGCTGAACAAGGCTTTGGACGAGACTGGCGCCAAG
ATACAGTCGTTCACCAACGCCGTCCACAACTGGACTGGAGACGCCTTGACAGCTCCGGGACTGGTGGCCGAGGCG
TTGGAAGTGCGCCAGTCACTGAATGACCTCAAATCAAAGGTGAAGGGAATCAGTAAGATCAGCGAGGCGGACCTC
AGGAAGAAGGGCGTGCATCTTATCCGGTTGGCGGATCCGGTCTTGAGCCTCATCGAGGCCGCTACCGAGGCGATC
GGCAAGATTGAAGGGATTCCCGGCGCCAGAACGTTGATCTACGTGATGCTCCAGGCGGAGAAGGAATCTTACCTC
GACCTGGTGAAAGCCCTCATGGAGAAGATGCCGGACAGTGTCTCCAAGTCTGGAGTGCCGGGCTCGCCAGACAAC
CTGAAGTCTTATACTCTGAACTTTGCCCAGCTTGAACTGGAAAAGTTTCTGAAGGCCCTGAAGCCGGCCCCTGAG
CAAAGCACTGTTTTTGATAAACTTATTTCCCAGTTTTCCTCCTATGTACAATGA
Gene >Ophun1|6761
ATGCGGCCTGCCATCATTCTCTTGGCCGTCGGCGCCCTCGCCGCCTCTCGCCAATCGAATAAAGTCTCTAACACC
AACTCCGTCTCTGACGCCAAATCCGTCTCCGATGTCGACACGCTGAACAAGGCTTTGGACGAGACTGGCGCCAAG
ATACAGTCGTTCACCAACGCCGTCCACAACTGGACTGGAGACGCCTTGACAGCTCCGGGACTGGTGGCCGAGGCG
TTGGAAGTGCGCCAGTCACTGAATGACCTCAAATCAAAGGTGAAGGGAATCAGTAAGATCAGCGAGGCGGACCTC
AGGAAGAAGGGCGTGCATCTTATCCGGTTGGCGGATCCGGTCTTGAGCCTCATCGAGGCCGCTACCGAGGCGATC
GGCAAGATTGAAGGGATTCCCGGCGCCAGAACGTTGATCTACGTGATGCTCCAGGCGGAGAAGGAATCTTACCTC
GACCTGGTGAAAGCCCTCATGGAGAAGATGCCGGACAGTGTCTCCAAGTCTGGAGTGCCGGGCTCGCCAGACAAC
CTGAAGTCTTATACTCTGAACTTTGCCCAGCTTGAACTGGAAAAGTTTCTGAAGGCCCTGAAGCCGGCCCCTGAG
CAAAGCACTGTTTTTGATAAACTTATTTCCCAGTTTTCCTCCTATGTACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail