Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6759
Gene name
LocationContig_77:15461..17876
Strand+
Gene length (bp)2415
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 3.0E-127 280 747
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 5.4E-57 29 274

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 10 765 0.0E+00
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 27 765 1.0E-34

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999704

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH92 3.0E-142 255 748

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup397
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6011
Ophiocordyceps australis 1348a (Ghana) OphauG2|6012
Ophiocordyceps australis map64 (Brazil) OphauB2|1816
Ophiocordyceps camponoti-floridani Ophcf2|02416
Ophiocordyceps camponoti-rufipedis Ophun1|6759 (this protein)
Ophiocordyceps kimflemingae Ophio5|2818
Ophiocordyceps subramaniannii Hirsu2|1943
Ophiocordyceps subramaniannii Hirsu2|9870

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6759
MALCRLLQVLISLGAAAAQAAPDFDALDLVDPLIGTVNGGNVFAGATVPYGMAKAVADSAEANQGGFAYDGRPVT
GFSVMHDSGTGGSPSLGLFALFPYASCPADDVDRCEFPKKSRLRFGGYATDTVQARPGYFGLTLGAGPRVEMTAT
EHAALFRFTFRPGDKPLILQDLTDLSDSRQDNGTVKVDVTGRRITGDAVFVPSFGQGRYRAYFCTEFGPGRRIVT
GGIFVDNRASVNVSELVISRGINGYPLPGGAFMHFADSQEPVLARVGISLISSQQACASAEAEIPDWNFQGIASA
AADGWRRKLESVAVDATGIDAGLVRSLYSGVYRTMISPQNYTGENPLWQDEGVPYFDSFYCIWDLFRSQLPLLTI
IDPHALAQMIRSLISVYEHDGWMPDCRMSLNRGYTQGGSNADNVLADAFVKGIHHGIDWEKGLEAAKKDADVEPF
DWSSHGRGGLDSWKALGYIPVSDFDYRGFGTHTRSLARGLNRPADAEKYQASSSNWRNLWRADQGSKLANGSDTG
FIGFFQPRHLNETWGSQDPLRCSPIDHSGSECSLTAGAGETFEGSLWEYGFFVPHAQAELIKLCGGPDAFVRRLT
YLHDNGINDIGNEPAFLTVFQYHYAGRPALSAQRVHSLIPSRFSDSPSGLPGNDDSGAMGAFVFFCMIGLFPNPG
QNVYLIAPPFFPSVNITSPLTGKTAVVRVVNFDAGYRNVFIQSATLNGERYTKNWIDHSFFTEGKELVLTVGERE
SDWGTAVEDLPPSMGTYAE*
Coding >Ophun1|6759
ATGGCCCTCTGCCGGCTGCTGCAAGTGCTTATCTCCCTCGGCGCCGCTGCCGCTCAGGCCGCCCCCGACTTCGAT
GCGCTTGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTGCCGGAGCTACGGTCCCGTAT
GGCATGGCAAAAGCCGTTGCCGACTCGGCCGAAGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTCACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGATCCCCTTCTCTCGGCCTCTTCGCTCTCTTCCCCTACGCT
TCCTGTCCGGCCGATGACGTCGATCGCTGCGAGTTTCCGAAAAAGAGCCGTCTTCGCTTCGGCGGCTATGCTACC
GATACGGTACAAGCCCGGCCCGGCTATTTCGGTCTCACCCTCGGGGCCGGGCCGAGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTCCGCTTTACTTTCCGACCGGGAGATAAGCCGTTGATTCTACAGGATTTGACGGATCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGTGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGATACCGTGCCTATTTCTGCACCGAATTTGGCCCCGGACGGCGCATCGTCACT
GGTGGCATCTTTGTTGATAATCGGGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGCTAT
CCCCTCCCTGGAGGCGCCTTTATGCACTTCGCCGACAGCCAAGAGCCGGTGCTGGCCCGCGTAGGCATCAGTCTC
ATCAGCTCTCAGCAGGCCTGTGCCAGCGCCGAGGCCGAGATACCGGACTGGAACTTTCAAGGCATCGCTTCTGCC
GCTGCCGATGGATGGAGGCGGAAGCTGGAGTCTGTGGCCGTGGACGCGACGGGTATTGACGCGGGTCTCGTTCGG
AGCCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCAGGAT
GAGGGTGTGCCTTACTTTGACTCCTTTTACTGCATCTGGGATCTGTTCCGCTCTCAGTTGCCGCTACTGACCATC
ATCGATCCTCACGCGCTGGCTCAGATGATCCGCTCGCTCATCTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGCGGCTACACCCAGGGGGGATCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCACCACGGCATCGACTGGGAAAAGGGGCTCGAAGCCGCCAAGAAGGACGCCGACGTAGAGCCCTTT
GACTGGTCTTCTCACGGCCGTGGAGGGCTCGACTCGTGGAAGGCTCTGGGTTACATCCCCGTCTCGGACTTTGAC
TACCGCGGCTTCGGCACTCATACCCGTAGCCTGGCCAGGGGTCTGAACCGACCTGCTGACGCGGAGAAGTATCAG
GCCTCGAGCAGCAACTGGCGCAATCTTTGGCGGGCGGATCAGGGCTCGAAGCTGGCTAACGGGTCTGATACGGGC
TTCATCGGCTTCTTCCAGCCTCGCCATCTTAACGAGACGTGGGGGTCGCAGGATCCGCTGCGGTGTAGCCCCATC
GATCACTCGGGGAGTGAGTGCTCGCTGACGGCCGGCGCGGGCGAGACGTTTGAGGGCAGTCTTTGGGAATACGGC
TTCTTCGTGCCTCACGCTCAGGCAGAACTCATCAAGCTCTGCGGCGGTCCGGATGCCTTTGTCCGGCGGCTGACG
TACCTTCACGATAATGGCATCAACGACATCGGAAACGAGCCCGCCTTCCTGACCGTCTTTCAGTATCATTACGCC
GGCCGGCCTGCGCTCTCGGCTCAGCGCGTCCACTCACTGATCCCGAGCCGCTTCTCCGACTCGCCTTCGGGACTA
CCGGGAAACGACGATAGCGGCGCAATGGGGGCCTTTGTCTTTTTCTGCATGATTGGTCTGTTTCCGAATCCGGGG
CAGAACGTCTATCTCATTGCTCCGCCCTTTTTCCCCAGCGTTAACATCACGAGTCCGCTGACGGGTAAGACGGCT
GTTGTGCGCGTCGTCAACTTCGACGCTGGATATCGGAATGTGTTTATCCAATCGGCTACCCTCAACGGAGAGAGG
TATACTAAGAATTGGATCGATCACTCGTTCTTTACTGAGGGGAAAGAACTTGTCTTGACGGTGGGTGAGAGGGAG
AGTGACTGGGGGACTGCGGTTGAGGATCTGCCGCCTAGCATGGGGACCTACGCTGAGTGA
Transcript >Ophun1|6759
ATGGCCCTCTGCCGGCTGCTGCAAGTGCTTATCTCCCTCGGCGCCGCTGCCGCTCAGGCCGCCCCCGACTTCGAT
GCGCTTGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTGCCGGAGCTACGGTCCCGTAT
GGCATGGCAAAAGCCGTTGCCGACTCGGCCGAAGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTCACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGATCCCCTTCTCTCGGCCTCTTCGCTCTCTTCCCCTACGCT
TCCTGTCCGGCCGATGACGTCGATCGCTGCGAGTTTCCGAAAAAGAGCCGTCTTCGCTTCGGCGGCTATGCTACC
GATACGGTACAAGCCCGGCCCGGCTATTTCGGTCTCACCCTCGGGGCCGGGCCGAGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTCCGCTTTACTTTCCGACCGGGAGATAAGCCGTTGATTCTACAGGATTTGACGGATCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGTGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGATACCGTGCCTATTTCTGCACCGAATTTGGCCCCGGACGGCGCATCGTCACT
GGTGGCATCTTTGTTGATAATCGGGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGCTAT
CCCCTCCCTGGAGGCGCCTTTATGCACTTCGCCGACAGCCAAGAGCCGGTGCTGGCCCGCGTAGGCATCAGTCTC
ATCAGCTCTCAGCAGGCCTGTGCCAGCGCCGAGGCCGAGATACCGGACTGGAACTTTCAAGGCATCGCTTCTGCC
GCTGCCGATGGATGGAGGCGGAAGCTGGAGTCTGTGGCCGTGGACGCGACGGGTATTGACGCGGGTCTCGTTCGG
AGCCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCAGGAT
GAGGGTGTGCCTTACTTTGACTCCTTTTACTGCATCTGGGATCTGTTCCGCTCTCAGTTGCCGCTACTGACCATC
ATCGATCCTCACGCGCTGGCTCAGATGATCCGCTCGCTCATCTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGCGGCTACACCCAGGGGGGATCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCACCACGGCATCGACTGGGAAAAGGGGCTCGAAGCCGCCAAGAAGGACGCCGACGTAGAGCCCTTT
GACTGGTCTTCTCACGGCCGTGGAGGGCTCGACTCGTGGAAGGCTCTGGGTTACATCCCCGTCTCGGACTTTGAC
TACCGCGGCTTCGGCACTCATACCCGTAGCCTGGCCAGGGGTCTGAACCGACCTGCTGACGCGGAGAAGTATCAG
GCCTCGAGCAGCAACTGGCGCAATCTTTGGCGGGCGGATCAGGGCTCGAAGCTGGCTAACGGGTCTGATACGGGC
TTCATCGGCTTCTTCCAGCCTCGCCATCTTAACGAGACGTGGGGGTCGCAGGATCCGCTGCGGTGTAGCCCCATC
GATCACTCGGGGAGTGAGTGCTCGCTGACGGCCGGCGCGGGCGAGACGTTTGAGGGCAGTCTTTGGGAATACGGC
TTCTTCGTGCCTCACGCTCAGGCAGAACTCATCAAGCTCTGCGGCGGTCCGGATGCCTTTGTCCGGCGGCTGACG
TACCTTCACGATAATGGCATCAACGACATCGGAAACGAGCCCGCCTTCCTGACCGTCTTTCAGTATCATTACGCC
GGCCGGCCTGCGCTCTCGGCTCAGCGCGTCCACTCACTGATCCCGAGCCGCTTCTCCGACTCGCCTTCGGGACTA
CCGGGAAACGACGATAGCGGCGCAATGGGGGCCTTTGTCTTTTTCTGCATGATTGGTCTGTTTCCGAATCCGGGG
CAGAACGTCTATCTCATTGCTCCGCCCTTTTTCCCCAGCGTTAACATCACGAGTCCGCTGACGGGTAAGACGGCT
GTTGTGCGCGTCGTCAACTTCGACGCTGGATATCGGAATGTGTTTATCCAATCGGCTACCCTCAACGGAGAGAGG
TATACTAAGAATTGGATCGATCACTCGTTCTTTACTGAGGGGAAAGAACTTGTCTTGACGGTGGGTGAGAGGGAG
AGTGACTGGGGGACTGCGGTTGAGGATCTGCCGCCTAGCATGGGGACCTACGCTGAGTGA
Gene >Ophun1|6759
ATGGCCCTCTGCCGGCTGCTGCAAGTGCTTATCTCCCTCGGCGCCGCTGCCGCTCAGGCCGCCCCCGACTTCGAT
GCGCTTGACCTCGTCGACCCGCTCATCGGGACCGTCAACGGCGGCAACGTCTTTGCCGGAGCTACGGTCCCGTAT
GGCATGGCAAAAGCCGTTGCCGACTCGGCCGAAGCGAATCAGGGCGGCTTCGCTTACGATGGCCGGCCCGTCACG
GGCTTCAGCGTCATGCACGACTCCGGTACCGGGGGATCCCCTTCTCTCGGCCTCTTCGCTCTCTTCCCCTACGCT
TCCTGTCCGGCCGATGACGTCGATCGCTGCGAGTTTCCGAAAAAGAGCCGTCTTCGCTTCGGCGGCTATGCTACC
GATACGGTACAAGCCCGGCCCGGCTATTTCGGTCTCACCCTCGGGGCCGGGCCGAGGGTGGAGATGACGGCGACG
GAGCACGCGGCGCTCTTCCGCTTTACTTTCCGACCGGGAGATAAGCCGTTGATTCTACAGGATTTGACGGATCTT
TCGGATTCGCGTCAGGATAACGGCACGGTAAAGGTCGACGTCACCGGCCGGCGCATCACCGGTGACGCCGTCTTC
GTGCCCAGCTTCGGTCAGGGCCGATACCGTGCCTATTTCTGCACCGAATTTGGCCCCGGACGGCGCATCGTCACT
GGTGGCATCTTTGTTGATAATCGGGCCAGCGTCAACGTCAGCGAGCTCGTCATCTCGCGCGGCATCAACGGCTAT
CCCCTCCCTGGAGGCGCCTTTATGCACTTCGCCGACAGCCAAGAGCCGGTGCTGGCCCGCGTAGGCATCAGTCTC
ATCAGCTCTCAGCAGGCCTGTGCCAGCGCCGAGGCCGAGATACCGGACTGGAACTTTCAAGGCATCGCTTCTGCC
GCTGCCGATGGATGGAGGCGGAAGCTGGAGTCTGTGGCCGTGGACGCGACGGGTATTGACGCGGGTCTCGTTCGG
AGCCTTTACTCGGGCGTCTATCGCACCATGATCAGTCCGCAGAATTACACGGGCGAGAACCCGCTGTGGCAGGAT
GAGGGTGTGCCTTACTTTGACTCCTTTTACTGCATCTGGGATCTGTTCCGCTCTCAGTTGCCGCTACTGACCATC
ATCGATCCTCACGCGCTGGCTCAGATGATCCGCTCGCTCATCTCCGTCTACGAGCACGACGGCTGGATGCCCGAC
TGCCGCATGAGCCTCAACCGCGGCTACACCCAGGGGGGATCCAACGCCGACAACGTCCTGGCCGACGCCTTCGTC
AAGGGCATCCACCACGGCATCGACTGGGAAAAGGGGCTCGAAGCCGCCAAGAAGGACGCCGACGTAGAGCCCTTT
GACTGGTCTTCTCACGGCCGTGGAGGGCTCGACTCGTGGAAGGCTCTGGGTTACATCCCCGTCTCGGACTTTGAC
TACCGCGGCTTCGGCACTCATACCCGTAGCGTGAGCCGGACGCTGGAATATAGCTATAATGACTTTTGCATCGGG
CAGCTGGCCAGGGGTCTGAACCGACCTGCTGACGCGGAGAAGTATCAGGCCTCGAGCAGCAACTGGCGCAATCTT
TGGCGGGCGGATCAGGGCTCGAAGCTGGCTAACGGGTCTGATACGGGCTTCATCGGCTTCTTCCAGCCTCGCCAT
CTTAACGAGACGTGGGGGTCGCAGGATCCGCTGCGGTGTAGCCCCATCGATCACTCGGGGAGTGAGTGCTCGCTG
ACGGCCGGCGCGGGCGAGACGTTTGAGGGCAGTCTTTGGGAATACGGCTTGTGAGTTTCTATCCTGGGTATAAGC
ACGATGTATATCTCGCTGACGCTGATGGACAGCTTCGTGCCTCACGCTCAGGCAGAACTCATCAAGCTCTGCGGC
GGTCCGGATGCCTTTGTCCGGCGGCTGACGTACCTTCACGATAATGGCATCAACGACATCGGAAACGAGCCCGCC
TTCCTGACCGTCTTTCAGTATCATTACGCCGGCCGGCCTGCGCTCTCGGCTCAGCGCGTCCACTCACTGATCCCG
AGCCGCTTCTCCGACTCGCCTTCGGGACTACCGGGAAACGACGATAGCGGCGCAATGGGGGCCTTTGTCTTTTTC
TGCATGATTGGTCTGTTTCCGAATCCGGGGCAGAACGTCTATCTCATTGCTCCGCCCTTTTTCCCCAGCGTTAAC
ATCACGAGTCCGCTGACGGGTAAGACGGCTGTTGTGCGCGTCGTCAACTTCGACGCTGGATATCGGAATGTGTTT
ATCCAATCGGCTACCCTCAACGGAGAGAGGTATACTAAGAATTGGATCGATCACTCGTTCTTTACTGAGGGGAAA
GAACTTGTCTTGACGGTGGGTGAGAGGGAGAGTGACTGGGGGACTGCGGTTGAGGATCTGCCGCCTAGCATGGGG
ACCTACGCTGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail