Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6758
Gene name
LocationContig_77:12718..14341
Strand-
Gene length (bp)1623
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.2E-74 41 475

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 30 480 3.0E-71
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 5 468 1.0E-54
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 5 468 1.0E-54
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 5 468 1.0E-52
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 24 475 4.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 30 480 3.0E-71
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 5 468 1.0E-54
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 5 468 1.0E-54
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 5 468 1.0E-52
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 24 475 4.0E-52
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 31 447 1.0E-47
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 12 447 5.0E-47
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 29 442 7.0E-44
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 25 447 2.0E-41
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 25 447 1.0E-39
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 56 447 1.0E-38
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 32 442 3.0E-37
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 31 457 3.0E-35
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 31 447 1.0E-34
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 30 447 3.0E-33
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 30 447 1.0E-32
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 60 447 2.0E-32
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 74 447 3.0E-32
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 21 476 1.0E-31
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 74 447 2.0E-31
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 75 447 3.0E-31
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 74 447 7.0E-31
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 74 447 9.0E-31
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 74 447 3.0E-30
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 30 447 5.0E-30
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 30 447 3.0E-29
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 51 447 3.0E-29
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 30 447 8.0E-29
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 74 447 8.0E-29
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 30 447 2.0E-28
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 1 476 2.0E-28
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 74 447 3.0E-28
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 74 447 7.0E-28
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 61 447 1.0E-27
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 74 447 7.0E-27
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 74 476 9.0E-27
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 30 447 3.0E-26
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 271 447 3.0E-26
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 271 447 3.0E-26
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 1 449 4.0E-26
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 274 447 5.0E-26
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 74 447 8.0E-26
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 30 447 2.0E-25
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 74 447 3.0E-25
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 28 476 5.0E-25
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 254 447 5.0E-25
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 55 447 6.0E-25
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 118 447 6.0E-25
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 74 447 6.0E-25
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 5 447 8.0E-25
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 77 482 1.0E-24
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 11 447 2.0E-24
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 30 447 2.0E-24
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 74 447 5.0E-24
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 74 447 7.0E-24
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 18 465 1.0E-23
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 254 447 1.0E-23
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 5 453 2.0E-23
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 265 447 3.0E-23
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 13 476 5.0E-23
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 106 447 7.0E-23
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 273 447 7.0E-23
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 23 474 8.0E-23
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 74 476 9.0E-23
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 24 465 1.0E-22
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 273 474 1.0E-22
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 58 476 2.0E-22
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 119 447 2.0E-22
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 50 472 2.0E-22
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 248 447 2.0E-22
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 74 476 2.0E-22
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 268 473 3.0E-22
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 286 447 3.0E-22
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 214 447 4.0E-22
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 118 438 4.0E-22
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 161 453 4.0E-22
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 221 447 4.0E-22
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 269 444 4.0E-22
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 74 447 5.0E-22
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 74 476 5.0E-22
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 58 463 8.0E-22
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 268 456 9.0E-22
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 267 463 2.0E-21
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 74 473 2.0E-21
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 45 447 2.0E-21
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 45 447 2.0E-21
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 273 455 3.0E-21
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 290 473 3.0E-21
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 50 463 3.0E-21
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 281 447 3.0E-21
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 113 438 3.0E-21
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 59 455 4.0E-21
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 119 447 4.0E-21
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 277 476 4.0E-21
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 59 447 5.0E-21
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 290 464 6.0E-21
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 268 462 7.0E-21
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 31 447 7.0E-21
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 119 437 7.0E-21
sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 245 448 7.0E-21
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 286 447 8.0E-21
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 120 476 9.0E-21
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 49 473 1.0E-20
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 268 456 1.0E-20
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 74 447 1.0E-20
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 277 479 1.0E-20
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 119 447 1.0E-20
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 62 447 1.0E-20
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 75 435 2.0E-20
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 264 462 2.0E-20
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 45 447 2.0E-20
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 6 456 2.0E-20
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 67 447 3.0E-20
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 27 454 3.0E-20
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 270 441 3.0E-20
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 227 456 3.0E-20
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 120 441 3.0E-20
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 277 479 4.0E-20
sp|P30100|C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1 273 479 4.0E-20
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 119 452 4.0E-20
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 264 441 4.0E-20
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 66 476 5.0E-20
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 75 451 6.0E-20
sp|P30099|C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1 273 479 6.0E-20
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 120 448 6.0E-20
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 31 482 6.0E-20
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 270 477 6.0E-20
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 59 447 7.0E-20
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 241 461 8.0E-20
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 41 463 9.0E-20
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 267 463 1.0E-19
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 45 447 1.0E-19
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 1 463 1.0E-19
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 270 455 1.0E-19
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 120 441 1.0E-19
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 155 447 1.0E-19
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 59 447 1.0E-19
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 141 447 1.0E-19
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 288 439 1.0E-19
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 100 460 1.0E-19
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 172 476 2.0E-19
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 190 447 2.0E-19
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 119 473 2.0E-19
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 286 447 2.0E-19
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 272 441 3.0E-19
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 175 447 3.0E-19
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 233 447 3.0E-19
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 45 447 3.0E-19
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 238 447 3.0E-19
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 122 428 3.0E-19
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 270 454 3.0E-19
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 101 447 3.0E-19
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 273 447 3.0E-19
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 56 444 4.0E-19
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 268 441 4.0E-19
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 120 441 4.0E-19
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 289 447 5.0E-19
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 268 441 5.0E-19
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 264 441 5.0E-19
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 1 463 5.0E-19
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 173 441 5.0E-19
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 24 447 5.0E-19
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 270 441 6.0E-19
sp|P14137|CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 26 473 6.0E-19
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 277 482 6.0E-19
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 59 479 6.0E-19
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 59 479 6.0E-19
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 3 447 6.0E-19
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 268 441 7.0E-19
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 270 475 7.0E-19
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 141 458 7.0E-19
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 45 447 8.0E-19
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 25 480 8.0E-19
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 260 452 8.0E-19
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 120 441 9.0E-19
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 219 447 9.0E-19
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 153 447 1.0E-18
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 31 457 1.0E-18
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 270 447 1.0E-18
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 21 473 1.0E-18
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 24 480 1.0E-18
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 207 428 2.0E-18
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 233 458 2.0E-18
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 3 447 2.0E-18
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 290 447 2.0E-18
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 28 473 2.0E-18
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 28 473 2.0E-18
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 275 447 2.0E-18
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 290 479 2.0E-18
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 1 463 2.0E-18
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 35 474 2.0E-18
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 24 447 2.0E-18
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 140 480 3.0E-18
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 11 447 3.0E-18
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 293 447 3.0E-18
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 290 447 3.0E-18
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 291 447 3.0E-18
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 292 463 3.0E-18
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 24 439 4.0E-18
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 268 441 4.0E-18
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 46 455 4.0E-18
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 120 441 4.0E-18
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 60 462 4.0E-18
sp|Q1ZXI7|C513F_DICDI Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 274 460 4.0E-18
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 267 476 4.0E-18
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 268 439 4.0E-18
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 31 454 5.0E-18
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 238 474 5.0E-18
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 142 455 6.0E-18
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 268 441 6.0E-18
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 41 463 6.0E-18
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 9 464 6.0E-18
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 74 447 6.0E-18
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 58 447 6.0E-18
sp|Q9V6H1|CP9H1_DROME Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 119 471 7.0E-18
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 120 441 7.0E-18
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 24 471 7.0E-18
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 142 463 7.0E-18
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 142 462 8.0E-18
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 1 466 8.0E-18
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 56 447 9.0E-18
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 28 473 9.0E-18
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 268 441 9.0E-18
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 56 465 1.0E-17
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 293 471 1.0E-17
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 58 447 1.0E-17
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 29 478 1.0E-17
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 268 441 1.0E-17
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 1 452 1.0E-17
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 267 447 1.0E-17
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 63 454 2.0E-17
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 213 428 2.0E-17
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 120 447 2.0E-17
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 56 460 2.0E-17
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 292 482 2.0E-17
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 103 447 2.0E-17
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 140 480 2.0E-17
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 268 441 2.0E-17
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 50 462 2.0E-17
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 280 447 2.0E-17
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 25 439 3.0E-17
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 268 447 3.0E-17
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 122 466 3.0E-17
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 264 441 3.0E-17
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 267 447 3.0E-17
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 264 441 3.0E-17
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 50 463 3.0E-17
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 284 449 4.0E-17
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 270 447 4.0E-17
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 6 433 4.0E-17
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 63 453 4.0E-17
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 276 447 5.0E-17
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 141 480 5.0E-17
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 260 432 6.0E-17
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 12 446 6.0E-17
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 59 463 6.0E-17
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 141 447 6.0E-17
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 140 454 6.0E-17
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 288 482 6.0E-17
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 4 482 6.0E-17
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 58 466 6.0E-17
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 1 456 8.0E-17
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 268 441 8.0E-17
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 268 441 8.0E-17
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 31 482 8.0E-17
sp|O61387|CP6B7_HELAM Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 130 476 1.0E-16
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 290 479 1.0E-16
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 270 447 1.0E-16
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 270 441 1.0E-16
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 285 447 1.0E-16
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 271 447 1.0E-16
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 289 447 1.0E-16
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 243 457 1.0E-16
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 119 447 1.0E-16
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 122 447 1.0E-16
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 1 463 2.0E-16
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 93 466 2.0E-16
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 272 474 2.0E-16
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 1 452 2.0E-16
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 260 463 2.0E-16
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 290 463 2.0E-16
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 272 463 2.0E-16
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 122 466 2.0E-16
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 21 462 2.0E-16
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 1 450 2.0E-16
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 2 441 2.0E-16
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 3 472 2.0E-16
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 30 447 2.0E-16
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 142 457 2.0E-16
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 31 452 3.0E-16
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 284 447 3.0E-16
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 58 466 3.0E-16
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 195 475 3.0E-16
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 2 441 3.0E-16
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 3 447 3.0E-16
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 141 447 4.0E-16
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 168 441 4.0E-16
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 26 447 4.0E-16
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 235 441 4.0E-16
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 73 447 4.0E-16
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 276 473 4.0E-16
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 235 455 4.0E-16
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 168 441 4.0E-16
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 285 447 4.0E-16
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 74 447 4.0E-16
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 63 471 4.0E-16
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 28 447 5.0E-16
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 292 467 5.0E-16
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 174 446 5.0E-16
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 120 456 5.0E-16
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 9 433 6.0E-16
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 289 447 6.0E-16
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 260 432 6.0E-16
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 93 466 6.0E-16
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 31 454 6.0E-16
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 281 447 6.0E-16
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 141 465 6.0E-16
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 282 473 8.0E-16
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 28 473 8.0E-16
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 243 450 8.0E-16
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 239 438 8.0E-16
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 201 447 8.0E-16
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 63 450 8.0E-16
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 247 447 8.0E-16
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 281 447 8.0E-16
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 172 467 8.0E-16
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 273 474 9.0E-16
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 99 447 1.0E-15
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 12 480 1.0E-15
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 293 447 1.0E-15
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 119 447 1.0E-15
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 172 436 1.0E-15
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 201 474 1.0E-15
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 271 447 1.0E-15
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 253 474 1.0E-15
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 131 476 1.0E-15
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 260 447 1.0E-15
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 11 441 1.0E-15
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 275 447 1.0E-15
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 4 472 1.0E-15
sp|Q54WB9|C513D_DICDI Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 250 452 2.0E-15
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 31 447 2.0E-15
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 46 466 2.0E-15
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 261 454 2.0E-15
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 58 466 2.0E-15
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 122 447 2.0E-15
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 288 447 2.0E-15
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 74 439 2.0E-15
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 287 447 2.0E-15
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 253 476 2.0E-15
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 218 474 2.0E-15
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 270 447 2.0E-15
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 174 438 3.0E-15
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 58 463 3.0E-15
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 292 447 3.0E-15
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 292 447 3.0E-15
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 267 447 3.0E-15
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 141 452 3.0E-15
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 292 473 3.0E-15
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 292 447 3.0E-15
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 221 476 3.0E-15
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 227 447 3.0E-15
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 217 447 3.0E-15
sp|Q43054|TCMO_POPKI Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 243 447 3.0E-15
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 58 474 3.0E-15
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 31 428 3.0E-15
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 31 463 3.0E-15
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 58 447 3.0E-15
sp|P10612|CP11A_PIG Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 129 447 3.0E-15
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 287 447 3.0E-15
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 243 447 4.0E-15
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 284 447 4.0E-15
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 244 467 4.0E-15
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 31 447 4.0E-15
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 256 460 4.0E-15
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 256 466 4.0E-15
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 214 447 4.0E-15
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 18 441 4.0E-15
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 267 476 4.0E-15
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 211 482 5.0E-15
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 1 447 5.0E-15
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 141 447 5.0E-15
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 12 467 6.0E-15
sp|Q9VGH1|CP315_DROME Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 172 447 6.0E-15
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 180 476 6.0E-15
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 63 463 6.0E-15
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 57 447 6.0E-15
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 174 453 7.0E-15
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 292 463 7.0E-15
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 292 447 7.0E-15
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 269 447 7.0E-15
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 274 447 8.0E-15
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 256 447 8.0E-15
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 141 447 8.0E-15
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 264 463 9.0E-15
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 59 456 9.0E-15
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 59 472 1.0E-14
sp|Q54SN0|C513E_DICDI Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 263 453 1.0E-14
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 268 462 1.0E-14
sp|Q54KV0|C513B_DICDI Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 244 453 1.0E-14
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 135 447 1.0E-14
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 141 447 1.0E-14
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 288 447 1.0E-14
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 52 471 1.0E-14
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 13 463 1.0E-14
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 292 463 1.0E-14
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 243 447 1.0E-14
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 52 447 1.0E-14
sp|Q54SK0|C508B_DICDI Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 3 447 1.0E-14
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 281 439 1.0E-14
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 223 447 1.0E-14
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 292 466 1.0E-14
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 118 454 1.0E-14
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 272 447 1.0E-14
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 270 447 1.0E-14
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 217 447 1.0E-14
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 262 438 1.0E-14
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 141 447 1.0E-14
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 11 441 2.0E-14
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 63 453 2.0E-14
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 268 456 2.0E-14
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 286 475 2.0E-14
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 52 471 2.0E-14
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 63 453 2.0E-14
sp|O93299|CP2K3_ONCMY Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1 280 474 2.0E-14
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 11 455 2.0E-14
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 278 447 2.0E-14
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 256 466 2.0E-14
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 254 447 2.0E-14
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 267 476 2.0E-14
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 24 472 2.0E-14
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 256 466 2.0E-14
sp|Q9W223|CP6D2_DROME Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 119 447 2.0E-14
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 31 478 2.0E-14
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 236 463 3.0E-14
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 268 447 3.0E-14
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 226 454 3.0E-14
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 144 447 3.0E-14
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 268 476 3.0E-14
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 268 462 3.0E-14
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 59 463 3.0E-14
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 270 479 3.0E-14
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 273 473 3.0E-14
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 238 464 3.0E-14
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 260 463 3.0E-14
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 268 447 3.0E-14
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 272 447 3.0E-14
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 151 456 3.0E-14
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 284 447 3.0E-14
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 174 438 3.0E-14
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 227 447 3.0E-14
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 288 444 3.0E-14
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 244 452 3.0E-14
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 285 447 3.0E-14
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 45 438 4.0E-14
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 260 447 4.0E-14
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 112 444 4.0E-14
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 286 441 4.0E-14
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 292 447 5.0E-14
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 24 463 5.0E-14
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 11 444 5.0E-14
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 149 426 5.0E-14
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 248 447 5.0E-14
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 54 467 5.0E-14
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 272 447 6.0E-14
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 201 447 6.0E-14
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 31 478 6.0E-14
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 236 463 6.0E-14
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 57 447 6.0E-14
sp|Q5IZM4|CP51_MYCVP Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 114 437 7.0E-14
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 1 441 7.0E-14
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 291 472 7.0E-14
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 268 447 7.0E-14
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 2 441 7.0E-14
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 31 447 7.0E-14
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 281 438 8.0E-14
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 286 455 8.0E-14
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 292 463 9.0E-14
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 174 460 9.0E-14
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 292 447 9.0E-14
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 74 448 1.0E-13
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 211 447 1.0E-13
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 41 444 1.0E-13
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 277 447 1.0E-13
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 268 464 1.0E-13
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 4 441 1.0E-13
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 272 471 1.0E-13
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 272 471 1.0E-13
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 268 441 1.0E-13
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 272 471 1.0E-13
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 224 447 1.0E-13
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 141 446 1.0E-13
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 273 447 1.0E-13
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 236 463 1.0E-13
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 201 447 1.0E-13
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 256 468 1.0E-13
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 292 463 1.0E-13
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 28 447 1.0E-13
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 277 447 1.0E-13
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 280 437 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1376
Ophiocordyceps australis 1348a (Ghana) OphauG2|5000
Ophiocordyceps australis map64 (Brazil) OphauB2|2330
Ophiocordyceps australis map64 (Brazil) OphauB2|6638
Ophiocordyceps camponoti-floridani Ophcf2|02415
Ophiocordyceps camponoti-floridani Ophcf2|05427
Ophiocordyceps camponoti-floridani Ophcf2|05428
Ophiocordyceps camponoti-rufipedis Ophun1|2176
Ophiocordyceps camponoti-rufipedis Ophun1|6758 (this protein)
Ophiocordyceps kimflemingae Ophio5|1176
Ophiocordyceps kimflemingae Ophio5|1177
Ophiocordyceps kimflemingae Ophio5|4504
Ophiocordyceps subramaniannii Hirsu2|6059
Ophiocordyceps subramaniannii Hirsu2|667
Ophiocordyceps subramaniannii Hirsu2|826
Ophiocordyceps subramaniannii Hirsu2|9048

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6758
MSFVYLIGCAFALAIIRSIIQVLRSSTSRLPGPWYTKWTSLVLDFHWMTASRTGYVHRLHQLYGPIVRIAPNEVA
VSDIEAVKTIYSTKETYRKSDFYRRIVTAGTESLFSTVDVDFHRRHRRLLAGPMSESSIKNLAPRVEARVDLAIS
RIAEEIKQRGSADVCKWWLFLATDVIGELTFGDSFRMLELGKKNDYVRELENVGRLSAIRSTFPSIVRFCRIVPL
PVFTKALEASINLRRYARDSLLRYRRLVEDDPNLAQETLFTKLFRAETDEKLSFDEMLSEAQSYIVAGSDTTANT
LTYLTWCVCRHPDIRSKLVQELRTLPPDFEDAHLHDLPYLNNVINESLRLYPAAPNALPRVVPPGGAELGGYRFD
ADTVVSAQAYSMHRDPVVFPNPESFLPERWLEPTKAMKDAFMAFGRGPRVCIGQHLARMELRLATARFFSTFPEA
HPSSREGMSDEDMKPRIHFILTPSGGRCLIQP*
Coding >Ophun1|6758
ATGTCCTTCGTCTACCTCATCGGCTGCGCCTTTGCGCTCGCCATCATCCGCTCCATCATCCAAGTCCTCCGCTCA
TCCACATCCCGTCTCCCAGGACCGTGGTACACCAAATGGACAAGCCTCGTCCTCGACTTCCACTGGATGACGGCC
TCACGCACAGGCTACGTCCACCGTCTCCACCAGCTCTACGGCCCCATCGTCCGCATCGCGCCCAACGAGGTCGCC
GTCTCAGACATCGAAGCCGTGAAAACCATCTACAGCACAAAGGAGACGTACCGCAAGTCCGACTTCTACCGCCGT
ATCGTCACCGCCGGCACCGAGTCGCTCTTCTCCACCGTCGATGTCGACTTTCACCGGAGGCACCGGAGGTTGCTC
GCCGGTCCCATGTCGGAGTCTTCCATCAAGAACCTGGCGCCTAGAGTCGAGGCTCGTGTCGACTTGGCCATCAGC
CGTATCGCCGAAGAGATTAAGCAGCGTGGATCGGCCGACGTCTGCAAGTGGTGGCTGTTCCTGGCCACGGACGTC
ATCGGGGAGCTCACCTTTGGCGACTCGTTCCGCATGCTGGAGCTCGGCAAGAAAAACGACTACGTCCGTGAGCTC
GAAAACGTCGGTCGTCTCTCAGCCATCCGCTCGACCTTTCCCTCCATCGTCCGCTTCTGCCGCATCGTGCCCCTG
CCCGTCTTCACAAAAGCGCTCGAGGCCTCAATCAACCTCCGTCGCTACGCCCGCGACTCCCTCCTTCGCTACCGC
CGTCTTGTCGAGGACGATCCCAACCTCGCGCAGGAAACGCTCTTCACCAAGCTCTTCCGAGCCGAGACGGACGAG
AAGCTCTCCTTTGACGAAATGCTCAGCGAGGCTCAGTCGTACATCGTTGCCGGAAGCGACACCACCGCCAACACC
CTCACCTACCTCACCTGGTGCGTCTGTCGACACCCAGACATCCGCTCGAAGCTGGTCCAAGAGCTGCGGACCCTG
CCGCCCGACTTTGAGGACGCTCATCTGCACGACCTGCCCTATCTCAACAACGTCATCAACGAGTCGCTCCGCCTT
TACCCTGCTGCTCCCAACGCTCTGCCTCGCGTCGTGCCCCCAGGAGGTGCCGAACTCGGCGGCTACCGCTTCGAC
GCAGACACCGTCGTCAGTGCTCAGGCCTACAGCATGCACCGCGATCCCGTCGTCTTCCCCAACCCGGAAAGCTTC
CTGCCCGAGCGGTGGTTGGAGCCGACAAAGGCCATGAAGGATGCTTTTATGGCTTTTGGCCGTGGTCCTCGAGTC
TGCATCGGCCAACACCTCGCTCGAATGGAGCTCCGCCTGGCCACCGCCCGCTTCTTTTCCACCTTTCCCGAAGCT
CATCCTTCTTCTCGCGAGGGCATGTCCGACGAAGACATGAAGCCGCGCATTCATTTCATACTGACCCCGTCCGGT
GGTCGGTGTCTTATTCAACCCTAG
Transcript >Ophun1|6758
ATGTCCTTCGTCTACCTCATCGGCTGCGCCTTTGCGCTCGCCATCATCCGCTCCATCATCCAAGTCCTCCGCTCA
TCCACATCCCGTCTCCCAGGACCGTGGTACACCAAATGGACAAGCCTCGTCCTCGACTTCCACTGGATGACGGCC
TCACGCACAGGCTACGTCCACCGTCTCCACCAGCTCTACGGCCCCATCGTCCGCATCGCGCCCAACGAGGTCGCC
GTCTCAGACATCGAAGCCGTGAAAACCATCTACAGCACAAAGGAGACGTACCGCAAGTCCGACTTCTACCGCCGT
ATCGTCACCGCCGGCACCGAGTCGCTCTTCTCCACCGTCGATGTCGACTTTCACCGGAGGCACCGGAGGTTGCTC
GCCGGTCCCATGTCGGAGTCTTCCATCAAGAACCTGGCGCCTAGAGTCGAGGCTCGTGTCGACTTGGCCATCAGC
CGTATCGCCGAAGAGATTAAGCAGCGTGGATCGGCCGACGTCTGCAAGTGGTGGCTGTTCCTGGCCACGGACGTC
ATCGGGGAGCTCACCTTTGGCGACTCGTTCCGCATGCTGGAGCTCGGCAAGAAAAACGACTACGTCCGTGAGCTC
GAAAACGTCGGTCGTCTCTCAGCCATCCGCTCGACCTTTCCCTCCATCGTCCGCTTCTGCCGCATCGTGCCCCTG
CCCGTCTTCACAAAAGCGCTCGAGGCCTCAATCAACCTCCGTCGCTACGCCCGCGACTCCCTCCTTCGCTACCGC
CGTCTTGTCGAGGACGATCCCAACCTCGCGCAGGAAACGCTCTTCACCAAGCTCTTCCGAGCCGAGACGGACGAG
AAGCTCTCCTTTGACGAAATGCTCAGCGAGGCTCAGTCGTACATCGTTGCCGGAAGCGACACCACCGCCAACACC
CTCACCTACCTCACCTGGTGCGTCTGTCGACACCCAGACATCCGCTCGAAGCTGGTCCAAGAGCTGCGGACCCTG
CCGCCCGACTTTGAGGACGCTCATCTGCACGACCTGCCCTATCTCAACAACGTCATCAACGAGTCGCTCCGCCTT
TACCCTGCTGCTCCCAACGCTCTGCCTCGCGTCGTGCCCCCAGGAGGTGCCGAACTCGGCGGCTACCGCTTCGAC
GCAGACACCGTCGTCAGTGCTCAGGCCTACAGCATGCACCGCGATCCCGTCGTCTTCCCCAACCCGGAAAGCTTC
CTGCCCGAGCGGTGGTTGGAGCCGACAAAGGCCATGAAGGATGCTTTTATGGCTTTTGGCCGTGGTCCTCGAGTC
TGCATCGGCCAACACCTCGCTCGAATGGAGCTCCGCCTGGCCACCGCCCGCTTCTTTTCCACCTTTCCCGAAGCT
CATCCTTCTTCTCGCGAGGGCATGTCCGACGAAGACATGAAGCCGCGCATTCATTTCATACTGACCCCGTCCGGT
GGTCGGTGTCTTATTCAACCCTAG
Gene >Ophun1|6758
ATGTCCTTCGTCTACCTCATCGGCTGCGCCTTTGCGCTCGCCATCATCCGCGTGAGCACCGACTTACACAAAACC
CCAACCCCAACTCCCAACTAACCTTTCCTCAGTCCATCATCCAAGTCCTCCGCTCATCCACATCCCGTCTCCCAG
GACCGTGGTACACCAAATGGACAAGCCTCGTCCTCGACTTCCACTGGATGACGGCCTCACGCACAGGCTACGTCC
ACCGTCTCCACCAGCTCTACGGCCCCATCGTCCGCATCGCGCCCAACGAGGTCGCCGTCTCAGACATCGAAGCCG
TGAAAACCATCTACAGCACAAAGGAGACGTACCGCAAGTCCGACTTCTACCGCCGTATCGTCACCGCCGGCACCG
AGTCGCTCTTCTCCACCGTCGATGTCGACTTTCACCGGAGGCACCGGAGGTTGCTCGCCGGTCCCATGTCGGAGT
CTTCCATCAAGAACCTGGCGCCTAGAGTCGAGGCTCGTGTCGACTTGGCCATCAGCCGTATCGCCGAAGAGATTA
AGCAGCGTGGATCGGCCGACGTCTGCAAGTGGTGGCTGTTCCTGGCCACGGACGTCATCGGGGAGCTCACCTTTG
GCGACTCGTTCCGCATGCTGGAGCTCGGCAAGGTCAGTTCAACCCCGGCTCGTCCATCCGGCTCACGCATCTAAA
TATCGAAATGATGATAGAAAAACGACTACGTCCGTGAGCTCGAAAACGTCGGTCGTCTCTCAGCCATCCGCTCGA
CCTTTCCCTCCATCGTCCGCTTCTGCCGCATCGTGCCCCTGCCCGTCTTCACAAAAGCGCTCGAGGCCTCAATCA
ACCTCCGTCGCTACGCCCGCGACTCCCTCCTTCGCTACCGCCGTCTTGTCGAGGACGATCCCAACCTCGCGCAGG
AAACGCTCTTCACCAAGCTCTTCCGAGCCGAGACGGACGAGAAGCTCTCCTTTGACGAAATGCTCAGCGAGGCTC
AGTCGTACATCGTTGCCGGAAGCGACACCACCGCCAACACCCTCACCTACCTCACCTGGTGCGTCTGTCGACACC
CAGACATCCGCTCGAAGCTGGTCCAAGAGCTGCGGACCCTGCCGCCCGACTTTGAGGACGCTCATCTGCACGACC
TGCCCTATCTCAACAACGTCATCAACGAGTCGCTCCGCCTTTACCCTGCTGCTCCCAACGCTCTGCCTCGCGTCG
TGCCCCCAGGAGGTGCCGAACTCGGCGGCTACCGCTTCGACGCAGACACCGTCGTCAGTGCTCAGGCCTACAGCA
TGCACCGCGATCCCGTCGTCTTCCCCAACCCGGAAAGCTTCCTGCCCGAGCGGTGGTTGGAGCCGACAAAGGCCA
TGAAGGATGCTTTTATGGCTTTTGGCCGTGGTCCTCGAGGTTGGTGCCCCTTCACCTTCAACCGCGGAACGTTCC
TGACGAGCGTCTCTTGTTGCAGTCTGCATCGGCCAACACCTCGCTCGAATGGAGCTCCGCCTGGCCACCGCCCGC
TTCTTTTCCACCTTTCCCGAAGCTCATCCTTCTTCTCGCGAGGGCATGTCCGACGAAGACATGAAGCCGCGCATT
CATTTCATACTGACCCCGTCCGGTGGTCGGTGTCTTATTCAACCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail