Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6754
Gene name
LocationContig_77:1574..3728
Strand-
Gene length (bp)2154
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-29 129 572
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-06 166 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 123 631 1.0E-35
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 92 580 2.0E-26
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 123 582 9.0E-20
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 98 582 1.0E-19
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 134 318 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 123 631 1.0E-35
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 92 580 2.0E-26
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 123 582 9.0E-20
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 98 582 1.0E-19
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 134 318 2.0E-10
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 138 336 2.0E-10
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 134 320 1.0E-09
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 124 279 4.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 138 292 2.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 166 317 3.0E-06
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 166 317 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 198 215 17
3 220 242 22
4 255 277 22
5 287 309 22
6 413 435 22
7 450 472 22
8 479 501 22
9 521 543 22
10 591 613 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6754
MVVRLVDLLQRQPLPDQDEDEDDDEAMARAEGGPRRPSAGPACRTLSSGSFHAGAPIPTLAGFRRASTHRYQTFP
ASVAPPAEAEAGGDDGDENDNDDDDDDDDGAGGSSSDGSSHEHEQTPLPVRQLLLLAFLSLAEQTALNSISPYLP
RMVASTPGIPPGQIGLYVGILASAFALAQLSTNFLWGYASDVVGRKPVLLAGTASLTGCFALFGLCRRYWHIVVV
HVAMGLLNGNAACVPTVLGEVTDRSNQSKAFTYLPVIYSIGGITGPALGGLLVGRIVPSHPYLAPNVCAAVLLAV
SVVVVAIWFEETLEEDDDEAGPWAPVFLHRVSSWLRSKFRPETSNDSHSWSSRWPHAQTTDQRRPLLSPDSSPSS
SSADDDHHVQDGMPSSKAAVQTKGPAWRDLLNHTTLLLLSTYLVFQLSNISFNSLYPIFAAAPAPAGRELDPGKI
GVSLSFAGLATILFQAFLYQPLKARTGSLGAYRLSLLGIAISMVLMPWVGYLDDEPLFGIGSGRLWLYAQLGIVL
VLKNICAVGGLSSVMLLITNSAPSHASLGTLNGVAQTLSALGRSFGPFVSGGLFSLSLDVRPKGEALAWSVFGGL
ALAGWICSLFIRGDGLESEDFDGDDESDGYGRA*
Coding >Ophun1|6754
ATGGTCGTGAGGCTTGTCGACTTGTTGCAGCGACAGCCTCTGCCCGACCAAGACGAAGACGAAGACGACGACGAA
GCCATGGCCCGCGCCGAGGGCGGCCCGCGTCGGCCCAGCGCCGGCCCCGCCTGCCGGACGCTGTCCTCGGGCTCG
TTCCATGCCGGGGCACCCATTCCGACGCTGGCGGGCTTCCGGCGCGCCTCGACGCATCGCTATCAGACTTTTCCT
GCGAGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGGTGGGGATGACGGTGATGAGAACGACAACGATGACGATGAC
GACGATGACGATGGGGCTGGCGGTAGCTCCAGTGACGGTTCCTCGCATGAGCACGAGCAGACTCCTCTCCCCGTC
CGCCAGCTCCTCCTCCTAGCCTTTCTCTCTCTCGCCGAGCAGACGGCCCTCAACTCCATCTCGCCTTATCTCCCG
CGCATGGTGGCCTCGACGCCCGGCATCCCCCCGGGCCAGATCGGGCTGTACGTCGGCATCCTGGCCAGCGCCTTT
GCCCTGGCTCAGCTGTCGACCAACTTCCTCTGGGGCTACGCCTCTGACGTCGTCGGTCGTAAGCCCGTGCTTCTG
GCTGGCACCGCGTCGTTGACTGGCTGCTTTGCCCTCTTTGGCCTGTGTCGACGCTACTGGCATATTGTTGTCGTT
CACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCCTGCGTGCCTACTGTTCTTGGCGAGGTGACGGATCGGTCG
AACCAGAGCAAGGCTTTTACCTACCTGCCCGTCATCTACTCCATAGGCGGCATCACTGGTCCGGCACTCGGCGGC
TTGTTGGTCGGCCGAATAGTGCCGAGTCACCCGTACCTTGCGCCCAACGTCTGCGCTGCCGTTTTACTCGCCGTC
AGTGTCGTCGTCGTCGCCATCTGGTTCGAAGAGACGCTTGAAGAGGATGACGACGAGGCGGGACCATGGGCGCCC
GTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCCAAGTTTCGTCCCGAGACGAGCAACGATTCTCATTCTTGG
AGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAGCGCAGACCCTTGCTATCGCCCGATTCGTCTCCCTCGTCC
TCTTCCGCCGACGATGACCACCATGTCCAAGACGGCATGCCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGGCCC
GCCTGGCGGGATCTCCTGAACCATACGACGCTCCTCCTCCTCTCCACCTATCTCGTCTTTCAGCTGTCCAACATC
AGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCCCCTGCGCCGGCGGGCCGCGAGCTGGATCCCGGCAAGATC
GGAGTCAGCCTTAGCTTTGCCGGCCTGGCCACTATTCTCTTTCAGGCCTTTCTCTACCAACCGCTCAAGGCCAGG
ACCGGGAGCCTGGGCGCGTACCGCCTGTCGCTGCTGGGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTTGGC
TATCTCGATGATGAGCCGCTGTTCGGCATTGGCAGCGGTCGTCTTTGGCTCTACGCACAGCTCGGCATTGTTTTG
GTGCTGAAGAATATCTGCGCTGTTGGCGGCCTTTCGAGCGTCATGCTTCTGATCACCAACTCGGCTCCGTCGCAC
GCCAGTCTCGGCACGCTCAACGGCGTGGCTCAAACGCTTTCGGCGCTGGGTCGCAGCTTTGGGCCTTTTGTCTCC
GGCGGCCTCTTTTCCCTGTCTCTCGACGTGCGGCCCAAGGGCGAGGCTCTCGCGTGGAGCGTCTTTGGGGGGCTC
GCTTTGGCCGGCTGGATCTGTTCGCTCTTTATCCGCGGCGATGGCCTGGAGAGTGAGGATTTTGACGGTGACGAC
GAGTCGGACGGTTATGGCCGCGCCTGA
Transcript >Ophun1|6754
ATGGTCGTGAGGCTTGTCGACTTGTTGCAGCGACAGCCTCTGCCCGACCAAGACGAAGACGAAGACGACGACGAA
GCCATGGCCCGCGCCGAGGGCGGCCCGCGTCGGCCCAGCGCCGGCCCCGCCTGCCGGACGCTGTCCTCGGGCTCG
TTCCATGCCGGGGCACCCATTCCGACGCTGGCGGGCTTCCGGCGCGCCTCGACGCATCGCTATCAGACTTTTCCT
GCGAGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGGTGGGGATGACGGTGATGAGAACGACAACGATGACGATGAC
GACGATGACGATGGGGCTGGCGGTAGCTCCAGTGACGGTTCCTCGCATGAGCACGAGCAGACTCCTCTCCCCGTC
CGCCAGCTCCTCCTCCTAGCCTTTCTCTCTCTCGCCGAGCAGACGGCCCTCAACTCCATCTCGCCTTATCTCCCG
CGCATGGTGGCCTCGACGCCCGGCATCCCCCCGGGCCAGATCGGGCTGTACGTCGGCATCCTGGCCAGCGCCTTT
GCCCTGGCTCAGCTGTCGACCAACTTCCTCTGGGGCTACGCCTCTGACGTCGTCGGTCGTAAGCCCGTGCTTCTG
GCTGGCACCGCGTCGTTGACTGGCTGCTTTGCCCTCTTTGGCCTGTGTCGACGCTACTGGCATATTGTTGTCGTT
CACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCCTGCGTGCCTACTGTTCTTGGCGAGGTGACGGATCGGTCG
AACCAGAGCAAGGCTTTTACCTACCTGCCCGTCATCTACTCCATAGGCGGCATCACTGGTCCGGCACTCGGCGGC
TTGTTGGTCGGCCGAATAGTGCCGAGTCACCCGTACCTTGCGCCCAACGTCTGCGCTGCCGTTTTACTCGCCGTC
AGTGTCGTCGTCGTCGCCATCTGGTTCGAAGAGACGCTTGAAGAGGATGACGACGAGGCGGGACCATGGGCGCCC
GTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCCAAGTTTCGTCCCGAGACGAGCAACGATTCTCATTCTTGG
AGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAGCGCAGACCCTTGCTATCGCCCGATTCGTCTCCCTCGTCC
TCTTCCGCCGACGATGACCACCATGTCCAAGACGGCATGCCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGGCCC
GCCTGGCGGGATCTCCTGAACCATACGACGCTCCTCCTCCTCTCCACCTATCTCGTCTTTCAGCTGTCCAACATC
AGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCCCCTGCGCCGGCGGGCCGCGAGCTGGATCCCGGCAAGATC
GGAGTCAGCCTTAGCTTTGCCGGCCTGGCCACTATTCTCTTTCAGGCCTTTCTCTACCAACCGCTCAAGGCCAGG
ACCGGGAGCCTGGGCGCGTACCGCCTGTCGCTGCTGGGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTTGGC
TATCTCGATGATGAGCCGCTGTTCGGCATTGGCAGCGGTCGTCTTTGGCTCTACGCACAGCTCGGCATTGTTTTG
GTGCTGAAGAATATCTGCGCTGTTGGCGGCCTTTCGAGCGTCATGCTTCTGATCACCAACTCGGCTCCGTCGCAC
GCCAGTCTCGGCACGCTCAACGGCGTGGCTCAAACGCTTTCGGCGCTGGGTCGCAGCTTTGGGCCTTTTGTCTCC
GGCGGCCTCTTTTCCCTGTCTCTCGACGTGCGGCCCAAGGGCGAGGCTCTCGCGTGGAGCGTCTTTGGGGGGCTC
GCTTTGGCCGGCTGGATCTGTTCGCTCTTTATCCGCGGCGATGGCCTGGAGAGTGAGGATTTTGACGGTGACGAC
GAGTCGGACGGTTATGGCCGCGCCTGA
Gene >Ophun1|6754
ATGGTCGTGAGGCTTGTCGACTTGTTGGTGAGCGACTGGTTGACGAAGAAAAAAAGAAAAAAGATCCATTAGCTG
GTAGGTGACGTCGTCGTCGGCCGATCATCGGCACCTTGCTGGCCCAATCGAGCAAGCGTCATTCCCCGTCGACGG
TCCCGGATTTTCCTTGACGAAGCAGCATGCCTCCTCCGTCCGCTCATCCTCCGGCCGATCCTCCAGCAGCGACAG
CCTCTGCCCGACCAAGACGAAGACGAAGACGACGACGAAGCCATGGCCCGCGCCGAGGGCGGCCCGCGTCGGCCC
AGCGCCGGCCCCGCCTGCCGGACGCTGTCCTCGGGCTCGTTCCATGCCGGGGCACCCATTCCGACGCTGGCGGGC
TTCCGGCGCGCCTCGACGCATCGCTATCAGACTTTTCCTGCGAGCGTGGCGCCGCCGGCTGAGGCTGAGGCTGGT
GGGGATGACGGTGATGAGAACGACAACGATGACGATGACGACGATGACGATGGGGCTGGCGGTAGCTCCAGTGAC
GGTTCCTCGCATGAGCACGAGCAGACTCCTCTCCCCGTCCGCCAGCTCCTCCTCCTAGCCTTTCTCTCTCTCGCC
GAGCAGACGGCCCTCAACTCCATCTCGCCTTATCTCCCGCGCATGGTGGCCTCGACGCCCGGCATCCCCCCGGGC
CAGATCGGGCTGTACGTCGGCATCCTGGCCAGCGCCTTTGCCCTGGCTCAGCTGTCGACCAACTTCCTCTGGGGC
TACGCCTCTGACGTCGTCGGTCGTAAGCCCGTGCTTCTGGCTGGCACCGCGTCGTTGACTGGCTGCTTTGCCCTC
TTTGGCCTGTGTCGACGCTACTGGCATATTGTTGTCGTTCACGTTGCCATGGGGCTGCTCAATGGGAACGCCGCC
TGCGTGCCTACTGTTCTTGGCGAGGTGACGGATCGGTCGAACCAGAGCAAGGCTTTTACCTACCTGCCCGTCATC
TACTCCATAGGCGGCATCACTGGTCCGGCACTCGGCGGCTTGTTGGTCGGCCGAATAGTGCCGAGTCACCCGTAC
CTTGCGCCCAACGTCTGCGCTGCCGTTTTACTCGCCGTCAGTGTCGTCGTCGTCGCCATCTGGTTCGAAGAGACG
CTTGAAGAGGATGACGACGAGGCGGGACCATGGGCGCCCGTCTTCCTCCATCGTGTCTCGTCTTGGCTGCGTTCC
AAGTTTCGTCCCGAGACGAGCAACGATTCTCATTCTTGGAGCTCGCGCTGGCCGCATGCTCAGACGACGGACCAG
CGCAGACCCTTGCTATCGCCCGATTCGTCTCCCTCGTCCTCTTCCGCCGACGATGACCACCATGTCCAAGACGGC
ATGCCCTCCTCCAAGGCTGCTGTCCAGACAAAGGGGCCCGCCTGGCGGGATCTCCTGAACCATACGACGCTCCTC
CTCCTCTCCACCTATCTCGTCTTTCAGCTGTCCAACATCAGCTTCAACAGCCTGTACCCCATCTTCGCCGCTGCC
CCTGCGCCGGCGGGCCGCGAGCTGGATCCCGGCAAGATCGGAGTCAGCCTTAGCTTTGCCGGCCTGGCCACTATT
CTCTTTCAGGCCTTTCTCTACCAACCGCTCAAGGCCAGGACCGGGAGCCTGGGCGCGTACCGCCTGTCGCTGCTG
GGCATAGCCATCAGCATGGTTCTCATGCCCTGGGTTGGCTATCTCGATGATGAGCCGCTGTTCGGCATTGGCAGC
GGTCGTCTTTGGCTCTACGCACAGCTCGGCATTGTTTTGGTGCTGAAGAATATCTGCGCTGTTGGCGGCCTTTCG
AGCGTCATGCTTCTGGTACGGCGTGCTTCCTTTCCGTATATCCTCTTCTTAACTGTGCTTTCATTGACATGTTTC
CAGATCACCAACTCGGCTCCGTCGCACGCCAGTCTCGGCACGCTCAACGGCGTGGCTCAAACGCTTTCGGCGCTG
GGTCGCAGCTTTGGGCCTTTTGTCTCCGGCGGCCTCTTTTCCCTGTCTCTCGACGTGCGGCCCAAGGGCGAGGCT
CTCGCGTGGAGCGTCTTTGGGGGGCTCGCTTTGGCCGGCTGGATCTGTTCGCTCTTTATCCGCGGCGATGGCCTG
GAGAGTGAGGATTTTGACGGTGACGACGAGTCGGACGGTTATGGCCGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail