Protein ID | Ophun1|6751 |
Gene name | |
Location | Contig_769:4048..5450 |
Strand | + |
Gene length (bp) | 1402 |
Transcript length (bp) | 1287 |
Coding sequence length (bp) | 1287 |
Protein length (aa) | 429 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00149 | Metallophos | Calcineurin-like phosphoesterase | 4.1E-22 | 63 | 181 |
PF00149 | Metallophos | Calcineurin-like phosphoesterase | 1.8E-06 | 249 | 331 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A8WGP3|PP4CA_DANRE | Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 | 20 | 428 | 3.0E-96 |
sp|O74789|YOU5_SCHPO | Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 | 23 | 428 | 3.0E-90 |
sp|A0C1E4|PPX3_PARTE | Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 | 18 | 171 | 3.0E-78 |
sp|A0CCD2|PPX4_PARTE | Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 | 18 | 171 | 4.0E-78 |
sp|Q6P861|PP4C_XENTR | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 | 23 | 180 | 1.0E-77 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A8WGP3|PP4CA_DANRE | Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 | 20 | 428 | 3.0E-96 |
sp|O74789|YOU5_SCHPO | Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 | 23 | 428 | 3.0E-90 |
sp|A0C1E4|PPX3_PARTE | Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 | 18 | 171 | 3.0E-78 |
sp|A0CCD2|PPX4_PARTE | Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 | 18 | 171 | 4.0E-78 |
sp|Q6P861|PP4C_XENTR | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 | 23 | 180 | 1.0E-77 |
sp|Q6IP91|PP4C_XENLA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 | 23 | 180 | 1.0E-77 |
sp|Q5BJ92|PP4C_RAT | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 | 18 | 180 | 1.0E-77 |
sp|Q5R6K8|PP4C_PONAB | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 | 18 | 180 | 1.0E-77 |
sp|P97470|PP4C_MOUSE | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 | 18 | 180 | 1.0E-77 |
sp|P60510|PP4C_HUMAN | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 | 18 | 180 | 1.0E-77 |
sp|A6H772|PP4C_BOVIN | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 | 18 | 180 | 1.0E-77 |
sp|Q10BT5|PP2A2_ORYSJ | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 | 23 | 376 | 2.0E-77 |
sp|A2XN40|PP2A2_ORYSI | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 | 23 | 376 | 2.0E-77 |
sp|P48529|PPX1_ARATH | Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 | 23 | 171 | 3.0E-77 |
sp|A9JRC7|PP4CB_DANRE | Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 | 23 | 180 | 3.0E-77 |
sp|Q9XGH7|PP2A_TOBAC | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 | 12 | 376 | 1.0E-76 |
sp|P11084|PP4C_RABIT | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 | 18 | 180 | 1.0E-76 |
sp|P23778|PP2A_BRANA | Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 | 16 | 376 | 5.0E-76 |
sp|O76932|PP4C_DROME | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 | 23 | 180 | 7.0E-76 |
sp|P48578|PP2A3_ARATH | Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 | 14 | 376 | 7.0E-76 |
sp|Q9Y0B7|PP4C_DICDI | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 | 23 | 180 | 1.0E-75 |
sp|A8XE00|PP4C1_CAEBR | Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 | 8 | 244 | 2.0E-75 |
sp|Q07100|PP2A4_ARATH | Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 | 16 | 376 | 3.0E-75 |
sp|Q06009|PP2A_MEDSA | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 | 23 | 376 | 3.0E-75 |
sp|P48528|PPX2_ARATH | Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 | 23 | 171 | 5.0E-75 |
sp|Q9XW79|PP4C1_CAEEL | Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 | 8 | 244 | 1.0E-74 |
sp|A3C4N5|PP2A4_ORYSJ | Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 | 15 | 376 | 2.0E-74 |
sp|Q64620|PPP6_RAT | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 | 23 | 428 | 7.0E-71 |
sp|Q9CQR6|PPP6_MOUSE | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 | 23 | 428 | 7.0E-71 |
sp|O00743|PPP6_HUMAN | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 | 23 | 428 | 9.0E-71 |
sp|P48463|PP2AA_CHICK | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 | 23 | 180 | 1.0E-70 |
sp|P0C5D7|PP2A4_ORYSI | Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 | 23 | 376 | 3.0E-70 |
sp|P62716|PP2AB_RAT | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 | 23 | 180 | 1.0E-69 |
sp|P62715|PP2AB_MOUSE | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 | 23 | 180 | 1.0E-69 |
sp|P62714|PP2AB_HUMAN | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 | 23 | 180 | 1.0E-69 |
sp|Q0P594|PP2AB_BOVIN | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 | 23 | 180 | 1.0E-69 |
sp|P49576|PPX1_PARTE | Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 | 23 | 171 | 1.0E-69 |
sp|P11611|PP2AB_RABIT | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 | 23 | 180 | 1.0E-69 |
sp|O04860|PP2A5_TOBAC | Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 | 23 | 180 | 1.0E-69 |
sp|A0DJ90|PPX2_PARTE | Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 | 23 | 171 | 1.0E-69 |
sp|P32345|PP4C_YEAST | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 | 23 | 171 | 2.0E-69 |
sp|P48529|PPX1_ARATH | Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 | 252 | 428 | 6.0E-69 |
sp|A0CCD2|PPX4_PARTE | Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 | 252 | 428 | 8.0E-69 |
sp|P36614|PPE1_SCHPO | Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 | 23 | 171 | 1.0E-68 |
sp|P67777|PP2AA_RABIT | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 | 23 | 180 | 1.0E-68 |
sp|P67776|PP2AA_PIG | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 | 23 | 180 | 1.0E-68 |
sp|P67775|PP2AA_HUMAN | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 | 23 | 180 | 1.0E-68 |
sp|P67774|PP2AA_BOVIN | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 | 23 | 180 | 1.0E-68 |
sp|Q07098|PP2A2_ARATH | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 | 23 | 180 | 1.0E-68 |
sp|Q0DBD3|PP2A1_ORYSJ | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 | 23 | 180 | 2.0E-68 |
sp|A2YEB4|PP2A1_ORYSI | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 | 23 | 180 | 2.0E-68 |
sp|P63331|PP2AA_RAT | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 | 23 | 180 | 2.0E-68 |
sp|P63330|PP2AA_MOUSE | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 | 23 | 180 | 2.0E-68 |
sp|Q9HFQ2|PP2A1_EMENI | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 | 11 | 180 | 2.0E-68 |
sp|Q0E2S4|PP2A3_ORYSJ | Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 | 23 | 180 | 2.0E-68 |
sp|A2X2G3|PP2A3_ORYSI | Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 | 23 | 180 | 2.0E-68 |
sp|Q9U9A3|PPP6_DICDI | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 | 23 | 180 | 2.0E-68 |
sp|P23696|PP2A_DROME | Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 | 17 | 180 | 2.0E-68 |
sp|Q9Y0B7|PP4C_DICDI | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 | 250 | 428 | 3.0E-68 |
sp|Q9XZE5|PP2AA_DICDI | Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 | 23 | 180 | 5.0E-68 |
sp|P48577|PP2A_ACEPE | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 | 23 | 403 | 9.0E-68 |
sp|P48528|PPX2_ARATH | Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 | 252 | 428 | 1.0E-67 |
sp|Q9XTT8|PP4C2_CAEEL | Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 | 23 | 180 | 1.0E-67 |
sp|P23594|PP2A1_YEAST | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 | 23 | 372 | 1.0E-67 |
sp|P11493|PP2AB_PIG | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 | 29 | 180 | 1.0E-67 |
sp|Q74ZR2|PP4C_ASHGO | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 | 243 | 428 | 1.0E-67 |
sp|P48579|PP2A_HELAN | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 | 18 | 180 | 1.0E-67 |
sp|Q9ZSE4|PP2A_HEVBR | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 | 23 | 180 | 2.0E-67 |
sp|P23636|PP2A2_SCHPO | Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 | 11 | 171 | 5.0E-67 |
sp|Q07099|PP2A1_ARATH | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 | 23 | 180 | 5.0E-67 |
sp|A9JRC7|PP4CB_DANRE | Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 | 250 | 428 | 8.0E-67 |
sp|Q5R6K8|PP4C_PONAB | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 | 250 | 428 | 1.0E-66 |
sp|P97470|PP4C_MOUSE | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 | 250 | 428 | 1.0E-66 |
sp|P60510|PP4C_HUMAN | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 | 250 | 428 | 1.0E-66 |
sp|A6H772|PP4C_BOVIN | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 | 250 | 428 | 1.0E-66 |
sp|P11084|PP4C_RABIT | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 | 250 | 428 | 1.0E-66 |
sp|Q74ZR2|PP4C_ASHGO | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 | 23 | 180 | 1.0E-66 |
sp|Q6P861|PP4C_XENTR | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 | 250 | 428 | 2.0E-66 |
sp|Q6IP91|PP4C_XENLA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 | 250 | 428 | 2.0E-66 |
sp|Q8X178|PP2A2_BLUGH | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 | 1 | 180 | 4.0E-66 |
sp|Q6FM81|PP4C_CANGA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 | 23 | 171 | 6.0E-66 |
sp|Q5BJ92|PP4C_RAT | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 | 250 | 428 | 8.0E-66 |
sp|O76932|PP4C_DROME | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 | 250 | 428 | 9.0E-66 |
sp|A0C1E4|PPX3_PARTE | Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 | 252 | 428 | 1.0E-65 |
sp|A0DJ90|PPX2_PARTE | Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 | 251 | 428 | 1.0E-65 |
sp|O04951|PP2A5_ARATH | Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 | 23 | 180 | 1.0E-65 |
sp|P48580|PP2A1_NEUCR | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 | 23 | 180 | 1.0E-65 |
sp|P49576|PPX1_PARTE | Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 | 252 | 428 | 2.0E-65 |
sp|P20604|PP11_YEAST | Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 | 23 | 180 | 2.0E-65 |
sp|Q9LHE7|FYPP3_ARATH | Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 | 23 | 180 | 7.0E-65 |
sp|Q8LSN3|FYPP_PEA | Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 | 23 | 180 | 5.0E-64 |
sp|P23635|PP2A1_SCHPO | Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 | 23 | 171 | 5.0E-64 |
sp|Q27884|PPP6_DROME | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 | 23 | 200 | 6.0E-64 |
sp|P23595|PP2A2_YEAST | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 | 11 | 372 | 7.0E-64 |
sp|Q9SX52|FYPP1_ARATH | Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 | 23 | 180 | 1.0E-63 |
sp|Q59KY8|SIT4_CANAL | Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 | 19 | 180 | 1.0E-63 |
sp|Q6CNT6|PP4C_KLULA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 | 23 | 171 | 1.0E-63 |
sp|A8XE00|PP4C1_CAEBR | Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 | 250 | 428 | 5.0E-63 |
sp|Q9XW79|PP4C1_CAEEL | Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 | 250 | 428 | 2.0E-62 |
sp|Q54RD6|PP2AB_DICDI | Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 | 23 | 171 | 1.0E-60 |
sp|A0CNL9|PP2A2_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 | 23 | 171 | 4.0E-60 |
sp|P32345|PP4C_YEAST | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 | 243 | 428 | 7.0E-60 |
sp|P48726|PP2A1_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 | 23 | 171 | 8.0E-60 |
sp|Q6BFF6|PP2A3_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 | 23 | 171 | 1.0E-59 |
sp|Q6CNT6|PP4C_KLULA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 | 243 | 428 | 2.0E-59 |
sp|Q10298|YD44_SCHPO | Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 | 23 | 171 | 4.0E-58 |
sp|Q6FM81|PP4C_CANGA | Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 | 251 | 428 | 5.0E-58 |
sp|Q9XTT8|PP4C2_CAEEL | Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 | 250 | 428 | 3.0E-57 |
sp|P32838|PP2A4_YEAST | Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 | 23 | 171 | 8.0E-57 |
sp|Q0E2S4|PP2A3_ORYSJ | Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 | 252 | 370 | 2.0E-53 |
sp|A2X2G3|PP2A3_ORYSI | Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 | 252 | 370 | 2.0E-53 |
sp|Q07098|PP2A2_ARATH | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 | 252 | 370 | 4.0E-53 |
sp|Q0DBD3|PP2A1_ORYSJ | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 | 252 | 370 | 5.0E-53 |
sp|A2YEB4|PP2A1_ORYSI | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 | 252 | 370 | 5.0E-53 |
sp|Q9U9A3|PPP6_DICDI | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 | 250 | 428 | 6.0E-53 |
sp|Q59KY8|SIT4_CANAL | Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 | 250 | 370 | 7.0E-53 |
sp|O04951|PP2A5_ARATH | Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 | 252 | 428 | 1.0E-52 |
sp|P62716|PP2AB_RAT | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 | 250 | 369 | 2.0E-52 |
sp|P62715|PP2AB_MOUSE | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P62714|PP2AB_HUMAN | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|Q0P594|PP2AB_BOVIN | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P11611|PP2AB_RABIT | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P67777|PP2AA_RABIT | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 | 250 | 369 | 2.0E-52 |
sp|P67776|PP2AA_PIG | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 | 250 | 369 | 2.0E-52 |
sp|P67775|PP2AA_HUMAN | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P67774|PP2AA_BOVIN | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P63331|PP2AA_RAT | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P63330|PP2AA_MOUSE | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 | 250 | 369 | 2.0E-52 |
sp|P11493|PP2AB_PIG | Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 | 250 | 369 | 2.0E-52 |
sp|Q09496|PPH6_CAEEL | Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 | 23 | 171 | 2.0E-52 |
sp|P48463|PP2AA_CHICK | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 | 250 | 369 | 3.0E-52 |
sp|Q07099|PP2A1_ARATH | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 | 252 | 369 | 6.0E-52 |
sp|P48580|PP2A1_NEUCR | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 | 252 | 369 | 1.0E-51 |
sp|Q8LSN3|FYPP_PEA | Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 | 250 | 389 | 1.0E-51 |
sp|P36614|PPE1_SCHPO | Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 | 250 | 428 | 3.0E-51 |
sp|Q9HFQ2|PP2A1_EMENI | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 | 252 | 369 | 3.0E-51 |
sp|P48579|PP2A_HELAN | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 | 252 | 370 | 3.0E-51 |
sp|P20604|PP11_YEAST | Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 | 250 | 374 | 3.0E-51 |
sp|Q9SX52|FYPP1_ARATH | Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 | 250 | 389 | 3.0E-51 |
sp|Q9XZE5|PP2AA_DICDI | Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 | 250 | 374 | 4.0E-51 |
sp|Q5A6B6|PPG1_CANAL | Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 | 23 | 173 | 4.0E-51 |
sp|Q9LHE7|FYPP3_ARATH | Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 | 250 | 389 | 5.0E-51 |
sp|Q8X178|PP2A2_BLUGH | Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 | 252 | 369 | 6.0E-51 |
sp|P23636|PP2A2_SCHPO | Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 | 252 | 379 | 8.0E-51 |
sp|P23696|PP2A_DROME | Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 | 250 | 369 | 1.0E-50 |
sp|Q9ZSE4|PP2A_HEVBR | Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 | 252 | 372 | 2.0E-50 |
sp|O04860|PP2A5_TOBAC | Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 | 252 | 376 | 6.0E-50 |
sp|P23635|PP2A1_SCHPO | Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 | 252 | 365 | 2.0E-49 |
sp|Q27884|PPP6_DROME | Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 | 252 | 428 | 4.0E-49 |
sp|Q09496|PPH6_CAEEL | Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 | 251 | 377 | 3.0E-46 |
sp|A0CNL9|PP2A2_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 | 252 | 370 | 8.0E-44 |
sp|P48726|PP2A1_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 | 252 | 370 | 9.0E-44 |
sp|Q6BFF6|PP2A3_PARTE | Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 | 252 | 369 | 9.0E-44 |
sp|Q10298|YD44_SCHPO | Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 | 251 | 428 | 1.0E-41 |
sp|Q27497|GLC7A_CAEEL | Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 | 26 | 171 | 3.0E-41 |
sp|Q61JR3|GLC7A_CAEBR | Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 | 26 | 171 | 3.0E-41 |
sp|P36873|PP1G_HUMAN | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 | 1 | 171 | 2.0E-40 |
sp|P32838|PP2A4_YEAST | Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 | 252 | 427 | 3.0E-40 |
sp|P63088|PP1G_RAT | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 | 1 | 171 | 4.0E-40 |
sp|P63087|PP1G_MOUSE | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 | 1 | 171 | 4.0E-40 |
sp|P61287|PP1G_BOVIN | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 | 1 | 171 | 4.0E-40 |
sp|Q8MJ46|PP1G_CANLF | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 | 1 | 171 | 5.0E-40 |
sp|Q7SZ10|PP1GB_XENLA | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 | 1 | 171 | 5.0E-40 |
sp|P30366|PP11_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 | 24 | 171 | 5.0E-40 |
sp|Q6NVU2|PPIG_XENTR | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 | 1 | 171 | 5.0E-40 |
sp|P36874|PP1GA_XENLA | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 | 1 | 171 | 5.0E-40 |
sp|O82734|PP18_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 | 35 | 171 | 1.0E-39 |
sp|P48489|PP1_ORYSJ | Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 | 24 | 171 | 1.0E-39 |
sp|P20654|PP1_EMENI | Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 | 26 | 180 | 1.0E-39 |
sp|Q9UW86|PP1_NEUCR | Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 | 26 | 180 | 1.0E-39 |
sp|P32945|PPQ1_YEAST | Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 | 34 | 171 | 2.0E-39 |
sp|Q9M9W3|PP19_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 | 35 | 171 | 2.0E-39 |
sp|P62137|PP1A_MOUSE | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 | 1 | 171 | 2.0E-39 |
sp|P13681|PP11_SCHPO | Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 | 26 | 180 | 2.0E-39 |
sp|Q5I085|PP1B_XENTR | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 | 18 | 171 | 2.0E-39 |
sp|Q6GQL2|PP1B_XENLA | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 | 18 | 171 | 2.0E-39 |
sp|P48484|PP14_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 | 24 | 171 | 2.0E-39 |
sp|P62142|PP1B_RAT | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|P62143|PP1B_RABIT | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|Q5R740|PP1B_PONAB | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 | 26 | 171 | 3.0E-39 |
sp|P61292|PP1B_PIG | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|P62141|PP1B_MOUSE | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|P62140|PP1B_HUMAN | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|P62207|PP1B_CHICK | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 | 26 | 171 | 3.0E-39 |
sp|Q8MJ47|PP1B_CANLF | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 | 26 | 171 | 3.0E-39 |
sp|Q3SWW9|PP1B_BOVIN | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 | 26 | 171 | 3.0E-39 |
sp|Q8WMS6|PP1A_CANLF | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 | 1 | 171 | 4.0E-39 |
sp|P48480|PP11_ACEPE | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 | 19 | 171 | 4.0E-39 |
sp|O82733|PP17_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 | 35 | 171 | 4.0E-39 |
sp|P62138|PP1A_RAT | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 | 1 | 171 | 6.0E-39 |
sp|P62139|PP1A_RABIT | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 | 1 | 171 | 6.0E-39 |
sp|P62136|PP1A_HUMAN | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 | 1 | 171 | 6.0E-39 |
sp|Q3T0E7|PP1A_BOVIN | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 | 1 | 171 | 6.0E-39 |
sp|P32598|PP12_YEAST | Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 | 26 | 171 | 6.0E-39 |
sp|P48482|PP12_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 | 37 | 171 | 7.0E-39 |
sp|P22198|PP1_MAIZE | Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 | 24 | 171 | 9.0E-39 |
sp|Q54RD6|PP2AB_DICDI | Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 | 251 | 428 | 1.0E-38 |
sp|P48462|PP1B_DROME | Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 | 26 | 171 | 1.0E-38 |
sp|P48490|PP1_PHAVU | Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 | 35 | 171 | 1.0E-38 |
sp|Q627N3|GLC7B_CAEBR | Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 | 26 | 171 | 2.0E-38 |
sp|P48727|GLC7B_CAEEL | Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 | 26 | 171 | 2.0E-38 |
sp|P48461|PP11_DROME | Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 | 26 | 171 | 2.0E-38 |
sp|P12982|PP12_DROME | Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 | 26 | 171 | 4.0E-38 |
sp|P48488|PP1_MEDSV | Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 | 35 | 171 | 6.0E-38 |
sp|O04857|PP12_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 | 19 | 171 | 1.0E-37 |
sp|P48487|PP1_BRAOL | Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 | 24 | 171 | 1.0E-37 |
sp|Q05547|PP13_DROME | Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 | 26 | 171 | 2.0E-37 |
sp|P48485|PP15_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 | 35 | 171 | 3.0E-37 |
sp|O04856|PP11_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 | 19 | 171 | 4.0E-37 |
sp|O15757|PP1_DICDI | Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 | 19 | 171 | 5.0E-37 |
sp|P33329|PPZ2_YEAST | Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 | 39 | 173 | 6.0E-37 |
sp|P26570|PPZ1_YEAST | Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 | 39 | 173 | 7.0E-37 |
sp|P48486|PP16_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 | 14 | 171 | 8.0E-37 |
sp|P48481|PP12_ACEPE | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 | 19 | 171 | 1.0E-36 |
sp|P48483|PP13_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 | 35 | 171 | 2.0E-36 |
sp|P23880|PP12_SCHPO | Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 | 35 | 171 | 5.0E-36 |
sp|Q5A6B6|PPG1_CANAL | Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 | 250 | 367 | 6.0E-36 |
sp|O04858|PP13_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 | 14 | 171 | 9.0E-36 |
sp|P23734|PP12_TRYBB | Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 | 35 | 180 | 4.0E-35 |
sp|O42773|PP2B1_CRYNH | Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 | 35 | 171 | 1.0E-34 |
sp|P23733|PP11_TRYBB | Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 | 35 | 180 | 1.0E-34 |
sp|P78968|PPZ_SCHPO | Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 | 39 | 173 | 1.0E-34 |
sp|P14747|PP2B2_YEAST | Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 | 39 | 370 | 1.0E-34 |
sp|Q12705|PP2B_SCHPO | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 | 35 | 171 | 2.0E-34 |
sp|Q27889|PP2B2_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 | 35 | 171 | 4.0E-34 |
sp|P48456|PP2B1_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 | 50 | 171 | 4.0E-34 |
sp|P63329|PP2BA_RAT | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 | 50 | 171 | 8.0E-34 |
sp|P63328|PP2BA_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 | 50 | 171 | 8.0E-34 |
sp|Q08209|PP2BA_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 | 50 | 171 | 8.0E-34 |
sp|P48452|PP2BA_BOVIN | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 | 50 | 171 | 8.0E-34 |
sp|Q4WUR1|PP2B_ASPFU | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 | 35 | 171 | 1.0E-33 |
sp|Q9VXF1|PP2B3_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 | 35 | 171 | 2.0E-33 |
sp|Q7YSW8|PP2BA_DICDI | Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 | 7 | 180 | 2.0E-33 |
sp|Q05681|PP2B_NEUCR | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 | 35 | 171 | 8.0E-33 |
sp|P20651|PP2BB_RAT | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 | 50 | 171 | 8.0E-33 |
sp|P16298|PP2BB_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 | 50 | 171 | 8.0E-33 |
sp|P48453|PP2BB_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 | 50 | 171 | 8.0E-33 |
sp|P48457|PP2B_EMENI | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 | 35 | 171 | 1.0E-32 |
sp|P48454|PP2BC_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 | 50 | 171 | 3.0E-32 |
sp|P11612|PPY_DROME | Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 | 35 | 171 | 3.0E-32 |
sp|P48455|PP2BC_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 | 50 | 171 | 8.0E-32 |
sp|O82733|PP17_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 | 252 | 398 | 2.0E-31 |
sp|P48460|YY06_CAEEL | Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 | 40 | 388 | 4.0E-31 |
sp|Q60EX6|BSL1_ORYSJ | Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 | 39 | 171 | 5.0E-31 |
sp|P62137|PP1A_MOUSE | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 | 252 | 369 | 8.0E-31 |
sp|Q8WMS6|PP1A_CANLF | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 | 252 | 369 | 8.0E-31 |
sp|P62138|PP1A_RAT | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 | 252 | 369 | 8.0E-31 |
sp|P62139|PP1A_RABIT | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 | 252 | 369 | 8.0E-31 |
sp|P62136|PP1A_HUMAN | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 | 252 | 369 | 8.0E-31 |
sp|Q3T0E7|PP1A_BOVIN | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 | 252 | 369 | 8.0E-31 |
sp|Q8L7U5|BSL1_ARATH | Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 | 39 | 171 | 1.0E-30 |
sp|P63088|PP1G_RAT | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 | 252 | 369 | 2.0E-30 |
sp|P63087|PP1G_MOUSE | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 | 252 | 369 | 2.0E-30 |
sp|P61287|PP1G_BOVIN | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 | 252 | 369 | 2.0E-30 |
sp|Q8MJ46|PP1G_CANLF | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 | 252 | 369 | 2.0E-30 |
sp|Q7SZ10|PP1GB_XENLA | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 | 252 | 369 | 2.0E-30 |
sp|Q6NVU2|PPIG_XENTR | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 | 252 | 369 | 2.0E-30 |
sp|P36874|PP1GA_XENLA | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 | 252 | 369 | 2.0E-30 |
sp|P23880|PP12_SCHPO | Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 | 252 | 370 | 2.0E-30 |
sp|P36873|PP1G_HUMAN | Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 | 252 | 369 | 3.0E-30 |
sp|P48487|PP1_BRAOL | Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 | 252 | 369 | 3.0E-30 |
sp|Q5I085|PP1B_XENTR | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 | 252 | 369 | 6.0E-30 |
sp|Q6GQL2|PP1B_XENLA | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 | 252 | 369 | 6.0E-30 |
sp|P62142|PP1B_RAT | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|P62143|PP1B_RABIT | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|Q5R740|PP1B_PONAB | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 | 252 | 369 | 6.0E-30 |
sp|P61292|PP1B_PIG | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|P62141|PP1B_MOUSE | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|P62140|PP1B_HUMAN | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|P62207|PP1B_CHICK | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 | 252 | 369 | 6.0E-30 |
sp|Q8MJ47|PP1B_CANLF | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 | 252 | 369 | 6.0E-30 |
sp|Q3SWW9|PP1B_BOVIN | Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 | 252 | 369 | 6.0E-30 |
sp|P48485|PP15_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 | 252 | 369 | 6.0E-30 |
sp|P48483|PP13_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 | 252 | 369 | 7.0E-30 |
sp|P48488|PP1_MEDSV | Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 | 252 | 386 | 8.0E-30 |
sp|Q9LR78|BSU1_ARATH | Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 | 39 | 171 | 9.0E-30 |
sp|P30366|PP11_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 | 252 | 369 | 1.0E-29 |
sp|P48482|PP12_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 | 252 | 369 | 1.0E-29 |
sp|Q627N3|GLC7B_CAEBR | Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 | 252 | 369 | 1.0E-29 |
sp|P48727|GLC7B_CAEEL | Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 | 252 | 369 | 1.0E-29 |
sp|Q3SWT6|PPE1_RAT | Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 | 40 | 368 | 1.0E-29 |
sp|P23287|PP2B1_YEAST | Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 | 51 | 173 | 1.0E-29 |
sp|P48489|PP1_ORYSJ | Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 | 252 | 369 | 2.0E-29 |
sp|P48486|PP16_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 | 252 | 386 | 2.0E-29 |
sp|P48484|PP14_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 | 252 | 370 | 3.0E-29 |
sp|P48480|PP11_ACEPE | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 | 252 | 369 | 3.0E-29 |
sp|P23777|PP1_BRANA | Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 | 68 | 171 | 8.0E-29 |
sp|Q27497|GLC7A_CAEEL | Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 | 252 | 369 | 1.0E-28 |
sp|Q61JR3|GLC7A_CAEBR | Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 | 252 | 369 | 1.0E-28 |
sp|O35655|PPE1_MOUSE | Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 | 40 | 368 | 1.0E-28 |
sp|P13681|PP11_SCHPO | Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 | 252 | 369 | 2.0E-28 |
sp|Q2QM47|BSL2_ORYSJ | Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 | 39 | 171 | 2.0E-28 |
sp|P48481|PP12_ACEPE | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 | 252 | 369 | 3.0E-28 |
sp|P23777|PP1_BRANA | Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 | 252 | 369 | 3.0E-28 |
sp|P48458|YT91_CAEEL | Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 | 27 | 157 | 3.0E-28 |
sp|Q9SHS7|BSL3_ARATH | Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 | 39 | 171 | 3.0E-28 |
sp|P32598|PP12_YEAST | Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 | 252 | 369 | 4.0E-28 |
sp|Q05547|PP13_DROME | Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 | 252 | 367 | 4.0E-28 |
sp|O04856|PP11_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 | 252 | 369 | 4.0E-28 |
sp|O04857|PP12_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 | 252 | 370 | 1.0E-27 |
sp|Q9SJF0|BSL2_ARATH | Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 | 39 | 171 | 1.0E-27 |
sp|O82734|PP18_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 | 252 | 369 | 2.0E-27 |
sp|P48462|PP1B_DROME | Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 | 252 | 369 | 2.0E-27 |
sp|P48461|PP11_DROME | Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 | 252 | 369 | 2.0E-27 |
sp|P48490|PP1_PHAVU | Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 | 252 | 369 | 3.0E-27 |
sp|P12982|PP12_DROME | Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 | 252 | 369 | 3.0E-27 |
sp|P48459|YSD1_CAEEL | Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 | 22 | 180 | 5.0E-27 |
sp|P20654|PP1_EMENI | Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 | 252 | 369 | 6.0E-27 |
sp|Q9UW86|PP1_NEUCR | Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 | 252 | 369 | 8.0E-27 |
sp|O04858|PP13_TOBAC | Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 | 252 | 370 | 1.0E-26 |
sp|O35385|PPE2_MOUSE | Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 | 23 | 367 | 1.0E-26 |
sp|P22198|PP1_MAIZE | Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 | 252 | 369 | 2.0E-26 |
sp|Q9M9W3|PP19_ARATH | Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 | 252 | 372 | 3.0E-26 |
sp|O14829|PPE1_HUMAN | Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 | 20 | 367 | 4.0E-26 |
sp|O15757|PP1_DICDI | Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 | 252 | 369 | 5.0E-26 |
sp|Q9FN02|PPP7_ARATH | Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 | 43 | 180 | 6.0E-26 |
sp|O14830|PPE2_HUMAN | Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 | 23 | 367 | 1.0E-25 |
sp|P23734|PP12_TRYBB | Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 | 250 | 370 | 3.0E-25 |
sp|P23733|PP11_TRYBB | Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 | 250 | 370 | 3.0E-25 |
sp|P53043|PPT1_YEAST | Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 | 46 | 171 | 4.0E-25 |
sp|P53041|PPP5_HUMAN | Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 | 39 | 186 | 1.0E-24 |
sp|P78968|PPZ_SCHPO | Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 | 250 | 370 | 2.0E-24 |
sp|P53042|PPP5_RAT | Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 | 39 | 186 | 3.0E-24 |
sp|Q60676|PPP5_MOUSE | Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 | 30 | 186 | 3.0E-24 |
sp|P33329|PPZ2_YEAST | Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 | 249 | 369 | 4.0E-24 |
sp|Q9LNG5|PPP7L_ARATH | Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 | 42 | 354 | 9.0E-24 |
sp|P11612|PPY_DROME | Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 | 252 | 370 | 1.0E-23 |
sp|Q84XU2|PPP5_ARATH | Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 | 249 | 367 | 1.0E-23 |
sp|P26570|PPZ1_YEAST | Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 | 250 | 369 | 7.0E-23 |
sp|Q84K11|PPP5_SOLLC | Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 | 252 | 367 | 8.0E-23 |
sp|O43049|PPT1_SCHPO | Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 | 64 | 299 | 8.0E-23 |
sp|P53041|PPP5_HUMAN | Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 | 249 | 368 | 1.0E-22 |
sp|P53042|PPP5_RAT | Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 | 249 | 368 | 2.0E-22 |
sp|Q60676|PPP5_MOUSE | Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 | 249 | 368 | 2.0E-22 |
sp|Q84XU2|PPP5_ARATH | Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 | 42 | 180 | 1.0E-21 |
sp|Q8SRZ0|PP1L_ENCCU | Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 | 28 | 171 | 1.0E-21 |
sp|P48458|YT91_CAEEL | Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 | 252 | 370 | 2.0E-21 |
sp|P48459|YSD1_CAEEL | Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 | 250 | 368 | 9.0E-20 |
sp|Q84K11|PPP5_SOLLC | Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 | 42 | 171 | 2.0E-19 |
sp|O43049|PPT1_SCHPO | Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 | 249 | 370 | 3.0E-19 |
sp|P34350|YK84_CAEEL | Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 | 252 | 369 | 4.0E-19 |
sp|Q9LR78|BSU1_ARATH | Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 | 252 | 370 | 9.0E-18 |
sp|Q9SHS7|BSL3_ARATH | Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 | 252 | 370 | 2.0E-17 |
sp|Q9SJF0|BSL2_ARATH | Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 | 252 | 370 | 2.0E-17 |
sp|Q8L7U5|BSL1_ARATH | Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 | 252 | 365 | 3.0E-17 |
sp|P53043|PPT1_YEAST | Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 | 253 | 367 | 3.0E-17 |
sp|P32945|PPQ1_YEAST | Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 | 252 | 368 | 4.0E-17 |
sp|Q7YSW8|PP2BA_DICDI | Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 | 249 | 365 | 5.0E-17 |
sp|Q2QM47|BSL2_ORYSJ | Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 | 252 | 370 | 5.0E-17 |
sp|P20651|PP2BB_RAT | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 | 253 | 370 | 1.0E-16 |
sp|P16298|PP2BB_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 | 253 | 370 | 1.0E-16 |
sp|P48453|PP2BB_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 | 253 | 370 | 1.0E-16 |
sp|Q08209|PP2BA_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 | 253 | 370 | 2.0E-16 |
sp|P48452|PP2BA_BOVIN | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 | 253 | 370 | 2.0E-16 |
sp|Q60EX6|BSL1_ORYSJ | Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 | 252 | 365 | 3.0E-16 |
sp|P63329|PP2BA_RAT | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 | 253 | 370 | 4.0E-16 |
sp|P63328|PP2BA_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 | 253 | 370 | 4.0E-16 |
sp|Q05681|PP2B_NEUCR | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 | 253 | 370 | 5.0E-16 |
sp|P48456|PP2B1_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 | 253 | 370 | 8.0E-16 |
sp|Q9LEV0|PPP7I_ARATH | Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 | 47 | 180 | 9.0E-16 |
sp|O42773|PP2B1_CRYNH | Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 | 253 | 370 | 1.0E-15 |
sp|Q12705|PP2B_SCHPO | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 | 253 | 370 | 3.0E-15 |
sp|P40421|RDGC_DROME | Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 | 60 | 368 | 3.0E-15 |
sp|Q4WUR1|PP2B_ASPFU | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 | 253 | 370 | 4.0E-15 |
sp|P48457|PP2B_EMENI | Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 | 253 | 370 | 7.0E-15 |
sp|P48454|PP2BC_HUMAN | Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 | 253 | 370 | 8.0E-15 |
sp|P23287|PP2B1_YEAST | Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 | 249 | 380 | 1.0E-14 |
sp|Q27889|PP2B2_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 | 253 | 370 | 2.0E-14 |
sp|Q9VXF1|PP2B3_DROME | Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 | 253 | 370 | 2.0E-14 |
sp|Q8SRZ0|PP1L_ENCCU | Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 | 252 | 404 | 2.0E-14 |
sp|P48455|PP2BC_MOUSE | Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 | 253 | 370 | 4.0E-14 |
sp|P34430|YL39_CAEEL | Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 | 49 | 116 | 7.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016787 | hydrolase activity | Yes |
GO:0003674 | molecular_function | No |
GO:0003824 | catalytic activity | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 47 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|6751 MSDLDKLNPPSPPLRTAAETSSDRAIAQLRACRPIPEPQVRELCHRARELLIEEGNVVTVTAPVTICGDIHGQFH DLMELFRVGGDVPDTNYLFMGDFVDRGFYSLESFLLLLCLKVRYPDRMTLIRGNHESRQITTVYGFYDECLRKYG SANVWRYCCDVFDYLALGAIVLGASKTLSGVADEEDDETEIEVCDQNGSVISRFSRQHADPPLLDGGSSPKANGA TTDRTGPAGSGASADADGSIGNPTGAVLCVHGGLSPLIDTVDKIRLIDRKQEVPHEGAMCDLLWSDPDDIDGWGL SPRGAGFLFGADIVKLFNHRNDLSLIARAHQLVMEGFKEMFDASIVTVWSAPNYCYRCGNVAAVLELSEDQSGTG VFARSNGDVGRSRGLMDAEPGAKGPARRYRVFQAAPQDSRGMPAKKPVADYFL* |
Coding | >Ophun1|6751 ATGAGCGATCTCGACAAGTTGAACCCCCCGTCCCCTCCGTTGAGGACTGCCGCTGAAACCTCTTCTGATAGGGCC ATCGCGCAGCTGCGCGCCTGTCGACCTATTCCCGAACCCCAAGTGCGAGAGCTTTGTCATCGCGCTCGCGAGCTG CTGATCGAGGAGGGTAATGTCGTGACGGTGACAGCGCCTGTGACGATATGCGGTGATATCCACGGCCAGTTTCAT GATCTCATGGAGCTGTTTCGCGTTGGCGGCGACGTGCCCGACACAAACTACCTCTTCATGGGAGACTTTGTCGAC CGTGGATTCTACTCTCTCGAATCTTTCCTCCTCCTTCTCTGCCTCAAGGTCCGATACCCAGATCGCATGACTCTC ATCCGCGGCAACCACGAATCGCGACAGATCACGACCGTCTACGGCTTCTACGACGAGTGCCTCCGCAAGTACGGC AGCGCCAACGTGTGGCGCTACTGCTGCGATGTCTTCGACTATCTAGCCCTAGGCGCCATCGTCCTAGGCGCCTCC AAGACGTTATCAGGCGTCGCCGACGAAGAAGACGACGAGACGGAAATCGAAGTCTGCGATCAAAACGGCAGCGTC ATAAGTCGCTTCTCGCGCCAGCATGCTGATCCACCCCTCCTCGACGGCGGCTCCTCTCCCAAGGCAAACGGCGCG ACGACGGACAGGACGGGCCCGGCTGGTTCCGGTGCCTCGGCCGATGCAGACGGCAGCATCGGCAACCCCACCGGC GCCGTCCTCTGCGTCCACGGCGGTCTCAGCCCCCTCATCGATACAGTCGACAAGATCCGCCTCATCGATCGCAAG CAAGAGGTTCCTCATGAGGGCGCCATGTGCGATCTCTTGTGGTCGGATCCAGACGACATCGACGGATGGGGCCTC TCCCCCCGCGGCGCAGGCTTCCTCTTCGGCGCCGACATCGTCAAGCTCTTCAACCACCGCAACGACCTAAGCCTC ATCGCCCGCGCCCACCAGCTCGTCATGGAGGGATTCAAAGAGATGTTTGACGCCTCCATCGTGACCGTCTGGTCA GCACCCAACTACTGCTACCGCTGCGGCAACGTCGCCGCCGTCCTCGAACTCAGCGAGGACCAATCCGGCACGGGC GTCTTTGCCCGCAGCAACGGCGACGTCGGGAGGAGCAGGGGTCTCATGGATGCTGAGCCCGGGGCCAAGGGTCCG GCCAGGAGGTATCGCGTCTTTCAGGCGGCGCCGCAGGATTCTAGGGGCATGCCTGCGAAGAAGCCCGTTGCGGAT TATTTCCTCTGA |
Transcript | >Ophun1|6751 ATGAGCGATCTCGACAAGTTGAACCCCCCGTCCCCTCCGTTGAGGACTGCCGCTGAAACCTCTTCTGATAGGGCC ATCGCGCAGCTGCGCGCCTGTCGACCTATTCCCGAACCCCAAGTGCGAGAGCTTTGTCATCGCGCTCGCGAGCTG CTGATCGAGGAGGGTAATGTCGTGACGGTGACAGCGCCTGTGACGATATGCGGTGATATCCACGGCCAGTTTCAT GATCTCATGGAGCTGTTTCGCGTTGGCGGCGACGTGCCCGACACAAACTACCTCTTCATGGGAGACTTTGTCGAC CGTGGATTCTACTCTCTCGAATCTTTCCTCCTCCTTCTCTGCCTCAAGGTCCGATACCCAGATCGCATGACTCTC ATCCGCGGCAACCACGAATCGCGACAGATCACGACCGTCTACGGCTTCTACGACGAGTGCCTCCGCAAGTACGGC AGCGCCAACGTGTGGCGCTACTGCTGCGATGTCTTCGACTATCTAGCCCTAGGCGCCATCGTCCTAGGCGCCTCC AAGACGTTATCAGGCGTCGCCGACGAAGAAGACGACGAGACGGAAATCGAAGTCTGCGATCAAAACGGCAGCGTC ATAAGTCGCTTCTCGCGCCAGCATGCTGATCCACCCCTCCTCGACGGCGGCTCCTCTCCCAAGGCAAACGGCGCG ACGACGGACAGGACGGGCCCGGCTGGTTCCGGTGCCTCGGCCGATGCAGACGGCAGCATCGGCAACCCCACCGGC GCCGTCCTCTGCGTCCACGGCGGTCTCAGCCCCCTCATCGATACAGTCGACAAGATCCGCCTCATCGATCGCAAG CAAGAGGTTCCTCATGAGGGCGCCATGTGCGATCTCTTGTGGTCGGATCCAGACGACATCGACGGATGGGGCCTC TCCCCCCGCGGCGCAGGCTTCCTCTTCGGCGCCGACATCGTCAAGCTCTTCAACCACCGCAACGACCTAAGCCTC ATCGCCCGCGCCCACCAGCTCGTCATGGAGGGATTCAAAGAGATGTTTGACGCCTCCATCGTGACCGTCTGGTCA GCACCCAACTACTGCTACCGCTGCGGCAACGTCGCCGCCGTCCTCGAACTCAGCGAGGACCAATCCGGCACGGGC GTCTTTGCCCGCAGCAACGGCGACGTCGGGAGGAGCAGGGGTCTCATGGATGCTGAGCCCGGGGCCAAGGGTCCG GCCAGGAGGTATCGCGTCTTTCAGGCGGCGCCGCAGGATTCTAGGGGCATGCCTGCGAAGAAGCCCGTTGCGGAT TATTTCCTCTGA |
Gene | >Ophun1|6751 ATGAGCGATCTCGACAAGTTGAACCCCCCGTCCCCTCCGTTGAGGACTGCCGCTGAAACCTCTTCTGATAGGGCC ATCGCGCAGCTGCGCGCCTGTCGACCTATTCCCGAACCCCAAGTGCGAGAGCTTTGTCATCGCGCTCGCGAGCTG CTGATCGAGGAGGGTAATGTCGTGACGGTGACAGCGCCTGTGACGGTACGGCTGTTACCGCTACTCGCTTCTCTG ACCTCGTTTTGCTGATGTCGGTGGTGGTAGATATGCGGTGATATCCACGGCCAGTTTCATGATCTCATGGAGCTG TTTCGCGTTGGCGGCGACGTGCCCGACACAAACTACCTCTTCATGGGTAAAGTCGCGTCCCGCTTCATCTCCACC AGAAGCAAGGCTGATGAGCTGAGCAGGAGACTTTGTCGACCGTGGATTCTACTCTCTCGAATCTTTCCTCCTCCT TCTCTGCCTCAAGGTCCGATACCCAGATCGCATGACTCTCATCCGCGGCAACCACGAATCGCGACAGATCACGAC CGTCTACGGCTTCTACGACGAGTGCCTCCGCAAGTACGGCAGCGCCAACGTGTGGCGCTACTGCTGCGATGTCTT CGACTATCTAGCCCTAGGCGCCATCGTCCTAGGCGCCTCCAAGACGTTATCAGGCGTCGCCGACGAAGAAGACGA CGAGACGGAAATCGAAGTCTGCGATCAAAACGGCAGCGTCATAAGTCGCTTCTCGCGCCAGCATGCTGATCCACC CCTCCTCGACGGCGGCTCCTCTCCCAAGGCAAACGGCGCGACGACGGACAGGACGGGCCCGGCTGGTTCCGGTGC CTCGGCCGATGCAGACGGCAGCATCGGCAACCCCACCGGCGCCGTCCTCTGCGTCCACGGCGGTCTCAGCCCCCT CATCGATACAGTCGACAAGATCCGCCTCATCGATCGCAAGCAAGAGGTTCCTCATGAGGGCGCCATGTGCGATCT CTTGTGGTCGGATCCAGACGACATCGACGGATGGGGCCTCTCCCCCCGCGGCGCAGGCTTCCTCTTCGGCGCCGA CATCGTCAAGCTCTTCAACCACCGCAACGACCTAAGCCTCATCGCCCGCGCCCACCAGCTCGTCATGGAGGGATT CAAAGAGATGTTTGACGCCTCCATCGTGACCGTCTGGTCAGCACCCAACTACTGCTACCGCTGCGGCAACGTCGC CGCCGTCCTCGAACTCAGCGAGGACCAATCCGGCACGGGCGTCTTTGCCCGCAGCAACGGCGACGTCGGGAGGAG CAGGGGTCTCATGGATGCTGAGCCCGGGGCCAAGGGTCCGGCCAGGAGGTATCGCGTCTTTCAGGCGGCGCCGCA GGATTCTAGGGGCATGCCTGCGAAGAAGCCCGTTGCGGATTATTTCCTCTGA |