Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6748
Gene name
LocationContig_768:6869..7498
Strand-
Gene length (bp)629
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08617 CGI-121 Kinase binding protein CGI-121 1.7E-31 9 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ID21|CG121_GIBZE EKC/KEOPS complex subunit CGI121 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CGI121 PE=3 SV=1 11 135 5.0E-41
sp|Q7SHG9|CG121_NEUCR EKC/KEOPS complex subunit cgi121 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cgi121 PE=3 SV=1 10 135 3.0E-29
sp|Q0C9R3|CG121_ASPTN EKC/KEOPS complex subunit cgi121 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cgi121 PE=3 SV=2 13 134 6.0E-19
sp|Q4WI37|CG121_ASPFU EKC/KEOPS complex subunit cgi121 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cgi121 PE=3 SV=1 13 134 2.0E-18
sp|A1CEY5|CG121_ASPCL EKC/KEOPS complex subunit cgi121 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cgi121 PE=3 SV=1 13 134 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ID21|CG121_GIBZE EKC/KEOPS complex subunit CGI121 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CGI121 PE=3 SV=1 11 135 5.0E-41
sp|Q7SHG9|CG121_NEUCR EKC/KEOPS complex subunit cgi121 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cgi121 PE=3 SV=1 10 135 3.0E-29
sp|Q0C9R3|CG121_ASPTN EKC/KEOPS complex subunit cgi121 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cgi121 PE=3 SV=2 13 134 6.0E-19
sp|Q4WI37|CG121_ASPFU EKC/KEOPS complex subunit cgi121 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cgi121 PE=3 SV=1 13 134 2.0E-18
sp|A1CEY5|CG121_ASPCL EKC/KEOPS complex subunit cgi121 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cgi121 PE=3 SV=1 13 134 1.0E-17
sp|Q1DYR7|CG121_COCIM EKC/KEOPS complex subunit CGI121 OS=Coccidioides immitis (strain RS) GN=CGI121 PE=3 SV=1 11 134 3.0E-17
sp|Q03705|CG121_YEAST EKC/KEOPS complex subunit CGI121 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CGI121 PE=1 SV=1 11 114 6.0E-12
sp|Q6FV72|CG121_CANGA EKC/KEOPS complex subunit CGI121 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CGI121 PE=3 SV=1 11 135 9.0E-12
sp|Q0UEM3|CG121_PHANO EKC/KEOPS complex subunit CGI121 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CGI121 PE=3 SV=2 19 134 1.0E-10
sp|Q8QZZ7|TPRKB_MOUSE EKC/KEOPS complex subunit Tprkb OS=Mus musculus GN=Tprkb PE=1 SV=1 13 119 2.0E-10
sp|Q9P7J3|CG121_SCHPO EKC/KEOPS complex subunit cgi121 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgi121 PE=3 SV=1 8 105 2.0E-10
sp|Q6C7C9|CG121_YARLI EKC/KEOPS complex subunit CGI121 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CGI121 PE=3 SV=1 11 135 9.0E-10
sp|Q5A519|CG121_CANAL EKC/KEOPS complex subunit CGI121 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGI121 PE=3 SV=1 10 134 1.0E-09
sp|Q6CT72|CG121_KLULA EKC/KEOPS complex subunit CGI121 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CGI121 PE=3 SV=1 5 87 2.0E-09
sp|Q75D21|CG121_ASHGO EKC/KEOPS complex subunit CGI121 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CGI121 PE=3 SV=2 5 135 2.0E-09
sp|Q5PQR8|TPRKB_RAT EKC/KEOPS complex subunit Tprkb OS=Rattus norvegicus GN=Tprkb PE=2 SV=1 13 100 5.0E-09
sp|Q9Y3C4|TPRKB_HUMAN EKC/KEOPS complex subunit TPRKB OS=Homo sapiens GN=TPRKB PE=1 SV=1 13 119 1.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1809
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4572
Ophiocordyceps australis map64 (Brazil) OphauB2|7818
Ophiocordyceps camponoti-floridani Ophcf2|05894
Ophiocordyceps camponoti-rufipedis Ophun1|6748 (this protein)
Ophiocordyceps kimflemingae Ophio5|4862
Ophiocordyceps subramaniannii Hirsu2|1771

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6748
MPSPILARWKNALETPNIHSEIVVNLSPSNNIADAYRRFGLSPSTTNLAVVKVTFPTETNPVPPSSHVIWHHLSA
NVQGQAVSLTDDNIEAVTALAKVRKNYKINNSLGWLPEDEAACRPQLEALVVSSMALRSL*
Coding >Ophun1|6748
ATGCCCTCTCCCATCCTCGCCCGATGGAAAAACGCCCTCGAAACACCCAATATCCACTCCGAGATCGTCGTCAAC
CTAAGCCCTTCCAACAACATTGCCGACGCCTATCGCCGCTTCGGCCTCTCGCCCTCCACCACAAACCTGGCTGTC
GTCAAGGTCACCTTCCCCACCGAAACCAACCCGGTCCCGCCTTCAAGCCATGTAATCTGGCACCATCTATCGGCA
AACGTGCAAGGGCAAGCCGTAAGCCTGACCGACGACAACATCGAGGCCGTCACCGCTCTGGCCAAGGTGCGCAAG
AACTACAAGATCAACAACAGCCTCGGCTGGCTCCCCGAAGACGAAGCCGCGTGTCGCCCCCAGCTCGAGGCCCTC
GTGGTGTCCTCGATGGCACTGCGCAGCCTATGA
Transcript >Ophun1|6748
ATGCCCTCTCCCATCCTCGCCCGATGGAAAAACGCCCTCGAAACACCCAATATCCACTCCGAGATCGTCGTCAAC
CTAAGCCCTTCCAACAACATTGCCGACGCCTATCGCCGCTTCGGCCTCTCGCCCTCCACCACAAACCTGGCTGTC
GTCAAGGTCACCTTCCCCACCGAAACCAACCCGGTCCCGCCTTCAAGCCATGTAATCTGGCACCATCTATCGGCA
AACGTGCAAGGGCAAGCCGTAAGCCTGACCGACGACAACATCGAGGCCGTCACCGCTCTGGCCAAGGTGCGCAAG
AACTACAAGATCAACAACAGCCTCGGCTGGCTCCCCGAAGACGAAGCCGCGTGTCGCCCCCAGCTCGAGGCCCTC
GTGGTGTCCTCGATGGCACTGCGCAGCCTATGA
Gene >Ophun1|6748
ATGCCCTCTCGTGCTTACTCGGACATTGCCCTGACCGACAGCGAAGCTCCTCTCGCGCAACCATCTCTTCGCCGC
CGTCTTTAAAGCCATCCTCGCCCGATGGAAAAACGCCCTCGAAACACCCAATATCCACTCCGAGATCGTCGTCAA
CCTAAGCCCTTCCAACAACGTGAGAACTTGCACCCCCCCCCCCCCCCCCCCACCCTCACCCCCCCCCCCCCTCCC
CCCCCTTTTTTTCCCTCTCAAAGCCTCGTCCCCGCCCGTCATCCAGACGTCGTCTAAATAAAGATTCAAATCACC
AACCGGACATGTAGATTGCCGACGCCTATCGCCGCTTCGGCCTCTCGCCCTCCACCACAAACCTGGCTGTCGTCA
AGGTCACCTTCCCCACCGAAACCAACCCGGTCCCGCCTTCAAGCCATGTAATCTGGCACCATCTATCGGCAAACG
TGCAAGGGCAAGCCGTAAGCCTGACCGACGACAACATCGAGGCCGTCACCGCTCTGGCCAAGGTGCGCAAGAACT
ACAAGATCAACAACAGCCTCGGCTGGCTCCCCGAAGACGAAGCCGCGTGTCGCCCCCAGCTCGAGGCCCTCGTGG
TGTCCTCGATGGCACTGCGCAGCCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail