Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6744
Gene name
LocationContig_768:786..2490
Strand-
Gene length (bp)1704
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40533|TED1_YEAST Protein TED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TED1 PE=1 SV=1 17 529 4.0E-53
sp|O42841|YFH2_SCHPO Uncharacterized protein C23A1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.02c PE=4 SV=2 142 482 8.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6744
MLVAAHLRHGLRLLVPLAVACTIYLYLYPVFGGCAFAVESRDSRDAFEQTKRLHWPFSGGAGDGAADNMAPFRLL
ALGDPQLEGDTSIPIAYLGVMPHLKSLAFRLAFRLEHPHLRDRIRMVLHDVIDVFFEDVPNLVESVRKRIDLFGN
DLYLAHIYRTLRWWSRPTHVSVLGDLVGSQWIEDGEFEQRGRRFWGKVFRGGERVPDKVAAYPMQNYSVTGVLDG
SAQEGVWTRRIMNVAGNHDIGYAGDLTPERMDRFERVFGKANYELRFALPMGDGDNATKRDMVASRRLPPQIRVL
VLNDMNLDTPAKDQGLQDRTYQFINDAISSGPAVEDRGQFTLVLTHIPLFKPNGVCVDGPFFDFYSPDEGGGVRE
QYLLSPDASKGLLEGVFGLSGNTGAPAQGRGRSGLILNGHDHEGCDTYHFINQTNGTSASDRLWEASRWTDARTR
GLPGTHMMPGRREITVRSMMGDFGGNAGLLSMWFNQSSWEWEYEYRDCPLGRQHLWWLTHLLDLGVLVCAALWPV
VVMLERFGVDVDGFFLRGVGWTRRWVETMGREGVKRLSCCRT*
Coding >Ophun1|6744
ATGTTGGTCGCGGCTCATCTCCGCCACGGCTTGCGCCTGTTGGTGCCTCTGGCGGTAGCCTGCACCATCTATCTC
TATCTCTACCCGGTCTTTGGCGGCTGTGCCTTTGCCGTCGAGTCGAGGGATTCCCGCGATGCCTTTGAGCAGACG
AAACGGCTCCATTGGCCCTTTTCCGGTGGTGCCGGCGATGGCGCTGCCGACAACATGGCGCCTTTCCGCCTCCTG
GCCCTGGGCGACCCCCAGCTCGAAGGCGACACGTCGATCCCCATCGCCTACCTGGGCGTGATGCCGCACTTGAAG
AGCTTGGCTTTCCGGCTGGCCTTTCGGCTAGAGCACCCGCACCTACGGGATCGGATCCGCATGGTCCTGCACGAC
GTCATCGACGTCTTCTTCGAGGACGTGCCGAACCTGGTGGAATCGGTCCGCAAGCGCATAGATCTCTTCGGAAAC
GACCTATACTTGGCGCACATATACCGCACACTGCGGTGGTGGTCCCGCCCGACCCACGTCTCCGTCCTCGGCGAC
CTGGTCGGCAGTCAGTGGATCGAGGACGGCGAGTTTGAGCAGAGGGGACGACGCTTCTGGGGAAAGGTCTTTCGT
GGCGGTGAGAGGGTTCCGGACAAGGTGGCGGCGTATCCCATGCAAAACTACTCCGTCACCGGCGTCCTCGACGGT
TCGGCCCAAGAAGGCGTCTGGACGCGGAGGATAATGAACGTGGCGGGCAACCACGACATTGGCTACGCCGGTGAC
CTGACGCCGGAGCGAATGGACCGGTTCGAGCGAGTCTTTGGGAAAGCCAACTACGAGCTCCGCTTTGCACTGCCG
ATGGGTGACGGCGATAATGCCACCAAGCGCGATATGGTAGCATCACGACGATTACCGCCGCAGATCCGCGTCCTC
GTTCTCAACGACATGAACCTCGACACGCCAGCCAAGGATCAAGGCTTACAGGACCGAACGTATCAGTTCATCAAC
GACGCCATCAGCTCAGGTCCGGCAGTGGAAGACCGCGGTCAGTTTACGCTGGTGTTGACGCACATTCCTCTCTTC
AAGCCCAACGGCGTCTGCGTCGACGGACCCTTTTTCGACTTTTACTCTCCCGACGAGGGCGGCGGCGTGCGGGAA
CAATATCTCCTCAGCCCGGATGCGAGCAAGGGCCTACTGGAAGGCGTCTTCGGCCTGAGCGGCAACACGGGCGCT
CCGGCACAGGGCCGAGGCCGCAGCGGGCTCATCCTCAACGGCCACGATCACGAGGGCTGCGACACGTACCACTTC
ATCAACCAGACCAACGGCACCAGCGCATCCGACCGATTGTGGGAGGCGTCCCGCTGGACCGACGCCCGGACCCGC
GGCCTCCCGGGCACGCACATGATGCCCGGCCGCCGGGAGATTACGGTCCGCAGCATGATGGGCGACTTTGGCGGC
AACGCGGGTCTGCTGAGCATGTGGTTCAACCAGAGTAGCTGGGAGTGGGAGTATGAGTATCGCGACTGTCCGTTG
GGGAGACAGCATCTCTGGTGGCTTACGCACCTGCTGGACCTGGGTGTGCTCGTGTGCGCTGCGCTATGGCCTGTG
GTGGTGATGCTCGAGAGATTTGGCGTTGATGTCGATGGATTCTTTCTGCGTGGAGTTGGATGGACGAGGCGATGG
GTCGAGACGATGGGGAGGGAAGGCGTCAAGCGTTTATCCTGCTGCAGGACATGA
Transcript >Ophun1|6744
ATGTTGGTCGCGGCTCATCTCCGCCACGGCTTGCGCCTGTTGGTGCCTCTGGCGGTAGCCTGCACCATCTATCTC
TATCTCTACCCGGTCTTTGGCGGCTGTGCCTTTGCCGTCGAGTCGAGGGATTCCCGCGATGCCTTTGAGCAGACG
AAACGGCTCCATTGGCCCTTTTCCGGTGGTGCCGGCGATGGCGCTGCCGACAACATGGCGCCTTTCCGCCTCCTG
GCCCTGGGCGACCCCCAGCTCGAAGGCGACACGTCGATCCCCATCGCCTACCTGGGCGTGATGCCGCACTTGAAG
AGCTTGGCTTTCCGGCTGGCCTTTCGGCTAGAGCACCCGCACCTACGGGATCGGATCCGCATGGTCCTGCACGAC
GTCATCGACGTCTTCTTCGAGGACGTGCCGAACCTGGTGGAATCGGTCCGCAAGCGCATAGATCTCTTCGGAAAC
GACCTATACTTGGCGCACATATACCGCACACTGCGGTGGTGGTCCCGCCCGACCCACGTCTCCGTCCTCGGCGAC
CTGGTCGGCAGTCAGTGGATCGAGGACGGCGAGTTTGAGCAGAGGGGACGACGCTTCTGGGGAAAGGTCTTTCGT
GGCGGTGAGAGGGTTCCGGACAAGGTGGCGGCGTATCCCATGCAAAACTACTCCGTCACCGGCGTCCTCGACGGT
TCGGCCCAAGAAGGCGTCTGGACGCGGAGGATAATGAACGTGGCGGGCAACCACGACATTGGCTACGCCGGTGAC
CTGACGCCGGAGCGAATGGACCGGTTCGAGCGAGTCTTTGGGAAAGCCAACTACGAGCTCCGCTTTGCACTGCCG
ATGGGTGACGGCGATAATGCCACCAAGCGCGATATGGTAGCATCACGACGATTACCGCCGCAGATCCGCGTCCTC
GTTCTCAACGACATGAACCTCGACACGCCAGCCAAGGATCAAGGCTTACAGGACCGAACGTATCAGTTCATCAAC
GACGCCATCAGCTCAGGTCCGGCAGTGGAAGACCGCGGTCAGTTTACGCTGGTGTTGACGCACATTCCTCTCTTC
AAGCCCAACGGCGTCTGCGTCGACGGACCCTTTTTCGACTTTTACTCTCCCGACGAGGGCGGCGGCGTGCGGGAA
CAATATCTCCTCAGCCCGGATGCGAGCAAGGGCCTACTGGAAGGCGTCTTCGGCCTGAGCGGCAACACGGGCGCT
CCGGCACAGGGCCGAGGCCGCAGCGGGCTCATCCTCAACGGCCACGATCACGAGGGCTGCGACACGTACCACTTC
ATCAACCAGACCAACGGCACCAGCGCATCCGACCGATTGTGGGAGGCGTCCCGCTGGACCGACGCCCGGACCCGC
GGCCTCCCGGGCACGCACATGATGCCCGGCCGCCGGGAGATTACGGTCCGCAGCATGATGGGCGACTTTGGCGGC
AACGCGGGTCTGCTGAGCATGTGGTTCAACCAGAGTAGCTGGGAGTGGGAGTATGAGTATCGCGACTGTCCGTTG
GGGAGACAGCATCTCTGGTGGCTTACGCACCTGCTGGACCTGGGTGTGCTCGTGTGCGCTGCGCTATGGCCTGTG
GTGGTGATGCTCGAGAGATTTGGCGTTGATGTCGATGGATTCTTTCTGCGTGGAGTTGGATGGACGAGGCGATGG
GTCGAGACGATGGGGAGGGAAGGCGTCAAGCGTTTATCCTGCTGCAGGACATGA
Gene >Ophun1|6744
ATGTTGGTCGCGGCTCATCTCCGCCACGGCTTGCGCCTGTTGGTGCCTCTGGCGGTAGCCTGCACCATCTATCTC
TATCTCTACCCGGTCTTTGGCGGCTGTGCCTTTGCCGTCGAGTCGAGGGATTCCCGCGATGCCTTTGAGCAGACG
AAACGGCTCCATTGGCCCTTTTCCGGTGGTGCCGGCGATGGCGCTGCCGACAACATGGCGCCTTTCCGCCTCCTG
GCCCTGGGCGACCCCCAGCTCGAAGGCGACACGTCGATCCCCATCGCCTACCTGGGCGTGATGCCGCACTTGAAG
AGCTTGGCTTTCCGGCTGGCCTTTCGGCTAGAGCACCCGCACCTACGGGATCGGATCCGCATGGTCCTGCACGAC
GTCATCGACGTCTTCTTCGAGGACGTGCCGAACCTGGTGGAATCGGTCCGCAAGCGCATAGATCTCTTCGGAAAC
GACCTATACTTGGCGCACATATACCGCACACTGCGGTGGTGGTCCCGCCCGACCCACGTCTCCGTCCTCGGCGAC
CTGGTCGGCAGTCAGTGGATCGAGGACGGCGAGTTTGAGCAGAGGGGACGACGCTTCTGGGGAAAGGTCTTTCGT
GGCGGTGAGAGGGTTCCGGACAAGGTGGCGGCGTATCCCATGCAAAACTACTCCGTCACCGGCGTCCTCGACGGT
TCGGCCCAAGAAGGCGTCTGGACGCGGAGGATAATGAACGTGGCGGGCAACCACGACATTGGCTACGCCGGTGAC
CTGACGCCGGAGCGAATGGACCGGTTCGAGCGAGTCTTTGGGAAAGCCAACTACGAGCTCCGCTTTGCACTGCCG
ATGGGTGACGGCGATAATGCCACCAAGCGCGATATGGTAGCATCACGACGATTACCGCCGCAGATCCGCGTCCTC
GTTCTCAACGACATGAACCTCGACACGCCAGCCAAGGATCAAGGCTTACAGGACCGAACGTATCAGTTCATCAAC
GACGCCATCAGCTCAGGTCCGGCAGTGGAAGACCGCGGTCAGTTTACGCTGGTGTTGACGCACATTCCTCTCTTC
AAGCCCAACGGCGTCTGCGTCGACGGACCCTTTTTCGACTTTTACTCTCCCGACGAGGGCGGCGGCGTGCGGGAA
CAATATCTCCTCAGCCCGGATGCGAGCAAGGGCCTACTGGAAGGCGTCTTCGGCCTGAGCGGCAACACGGGCGCT
CCGGCACAGGGCCGAGGCCGCAGCGGGCTCATCCTCAACGGCCACGATCACGAGGGCTGCGACACGTACCACTTC
ATCAACCAGACCAACGGCACCAGCGCATCCGACCGATTGTGGGAGGCGTCCCGCTGGACCGACGCCCGGACCCGC
GGCCTCCCGGGCACGCACATGATGCCCGGCCGCCGGGAGATTACGGTCCGCAGCATGATGGGCGACTTTGGCGGC
AACGCGGGTCTGCTGAGCATGTGGTTCAACCAGAGTAGCTGGGAGTGGGAGTATGAGTATCGCGACTGTCCGTTG
GGGAGACAGCATCTCTGGTGGCTTACGCACCTGCTGGACCTGGGTGTGCTCGTGTGCGCTGCGCTATGGCCTGTG
GTGGTGATGCTCGAGAGATTTGGCGTTGATGTCGATGGATTCTTTCTGCGTGGAGTTGGATGGACGAGGCGATGG
GTCGAGACGATGGGGAGGGAAGGCGTCAAGCGTTTATCCTGCTGCAGGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail