Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6741
Gene name
LocationContig_766:5396..6140
Strand-
Gene length (bp)744
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain 2.9E-50 59 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 14 235 2.0E-93
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 28 235 1.0E-87
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 31 235 1.0E-84
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 30 235 1.0E-82
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 30 235 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 14 235 2.0E-93
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 28 235 1.0E-87
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 31 235 1.0E-84
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 30 235 1.0E-82
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 30 235 3.0E-82
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 13 235 4.0E-78
sp|Q0CEF5|AGALG_ASPTN Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglG PE=3 SV=1 31 235 6.0E-72
sp|Q5ARP5|AGALG_EMENI Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglG PE=2 SV=1 32 234 3.0E-65
sp|P43467|AGAL1_PEDPE Alpha-galactosidase 1 OS=Pediococcus pentosaceus GN=agaR PE=3 SV=1 41 242 3.0E-20
sp|P43469|AGAL2_PEDPE Alpha-galactosidase 2 OS=Pediococcus pentosaceus GN=agaS PE=3 SV=1 92 234 3.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 30 0.999598

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup16879
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|6741 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6741
MPMTSRPPLRDLVVAAVVVAAIGIPRFALASEAIVVKDGSFALNGDDVSYRFHVDVATGDLVSDHFGAPVDEQSV
DADLASLNGWVGLLGRLPREMPDLGRGDFRTPAVQIRQTAGYTVSDFRYRSHELVQGKPPLQGLPSTFGSDEDVS
TLLVHLYDNYSNVAADLSYSIFPRHDAVVRSVSITNRGGGNITVEKLASMSVDMPYGDYDMVELKGDWAREAMRV
RRKVDYGTQGRVKDSSSPTDGS*
Coding >Ophun1|6741
ATGCCCATGACCTCTCGTCCTCCTCTCCGCGACCTCGTCGTCGCCGCCGTCGTCGTCGCGGCCATCGGCATCCCT
CGCTTCGCCCTCGCTTCGGAAGCCATCGTCGTCAAGGATGGCTCGTTCGCGCTGAATGGAGATGACGTCTCGTAC
CGCTTCCATGTCGATGTCGCGACGGGGGATCTCGTCTCGGATCACTTCGGCGCTCCCGTCGATGAGCAATCTGTC
GATGCTGATCTCGCCTCTTTGAACGGCTGGGTTGGTCTTCTGGGCCGGCTGCCGCGCGAGATGCCGGACTTGGGC
CGGGGGGACTTCCGGACTCCGGCCGTGCAGATCCGTCAGACGGCCGGTTATACCGTCAGCGACTTCCGCTATCGA
TCCCACGAGCTGGTTCAGGGCAAGCCTCCGCTGCAGGGCCTGCCGTCGACCTTTGGCTCTGATGAGGATGTCTCT
ACTTTGCTCGTCCATCTGTACGACAACTACAGCAATGTCGCCGCTGATCTCTCGTACTCCATCTTTCCCCGTCAC
GATGCCGTCGTGCGCAGCGTCAGCATCACCAACAGGGGCGGGGGCAACATTACCGTCGAGAAGCTGGCTAGCATG
AGCGTCGACATGCCGTATGGAGACTATGACATGGTTGAGCTCAAGGGCGACTGGGCGCGAGAGGCCATGAGGGTC
CGCCGCAAGGTCGACTACGGCACTCAAGGGCGAGTGAAAGACTCTTCTTCTCCGACGGATGGAAGCTGA
Transcript >Ophun1|6741
ATGCCCATGACCTCTCGTCCTCCTCTCCGCGACCTCGTCGTCGCCGCCGTCGTCGTCGCGGCCATCGGCATCCCT
CGCTTCGCCCTCGCTTCGGAAGCCATCGTCGTCAAGGATGGCTCGTTCGCGCTGAATGGAGATGACGTCTCGTAC
CGCTTCCATGTCGATGTCGCGACGGGGGATCTCGTCTCGGATCACTTCGGCGCTCCCGTCGATGAGCAATCTGTC
GATGCTGATCTCGCCTCTTTGAACGGCTGGGTTGGTCTTCTGGGCCGGCTGCCGCGCGAGATGCCGGACTTGGGC
CGGGGGGACTTCCGGACTCCGGCCGTGCAGATCCGTCAGACGGCCGGTTATACCGTCAGCGACTTCCGCTATCGA
TCCCACGAGCTGGTTCAGGGCAAGCCTCCGCTGCAGGGCCTGCCGTCGACCTTTGGCTCTGATGAGGATGTCTCT
ACTTTGCTCGTCCATCTGTACGACAACTACAGCAATGTCGCCGCTGATCTCTCGTACTCCATCTTTCCCCGTCAC
GATGCCGTCGTGCGCAGCGTCAGCATCACCAACAGGGGCGGGGGCAACATTACCGTCGAGAAGCTGGCTAGCATG
AGCGTCGACATGCCGTATGGAGACTATGACATGGTTGAGCTCAAGGGCGACTGGGCGCGAGAGGCCATGAGGGTC
CGCCGCAAGGTCGACTACGGCACTCAAGGGCGAGTGAAAGACTCTTCTTCTCCGACGGATGGAAGCTGA
Gene >Ophun1|6741
ATGCCCATGACCTCTCGTCCTCCTCTCCGCGACCTCGTCGTCGCCGCCGTCGTCGTCGCGGCCATCGGCATCCCT
CGCTTCGCCCTCGCTTCGGAAGCCATCGTCGTCAAGGATGGCTCGTTCGCGCTGAATGGAGATGACGTCTCGTAC
CGCTTCCATGTCGATGTCGCGACGGGGGATCTCGTCTCGGATCACTTCGGCGCTCCCGTCGATGAGCAATCTGTC
GATGCTGATCTCGCCTCTTTGAACGGCTGGGTTGGTCTTCTGGGCCGGCTGCCGCGCGAGATGCCGGACTTGGGC
CGGGGGGACTTCCGGACTCCGGCCGTGCAGATCCGTCAGACGGCCGGTTATACCGTCAGCGACTTCCGCTATCGA
TCCCACGAGCTGGTTCAGGGCAAGCCTCCGCTGCAGGGCCTGCCGTCGACCTTTGGCTCTGATGAGGATGTCTCT
ACTTTGCTCGTCCATCTGTACGACAACTACAGCAATGTCGCCGCTGATCTCTCGTACTCCATCTTTCCCCGTCAC
GATGCCGTCGTGCGCAGCGTCAGCATCACCAACAGGGGCGGGGGCAACATTACCGTCGAGAAGCTGGCTAGCATG
AGCGTCGACATGCCGTATGGAGACTATGACATGGTTGAGCTCAAGGGCGACTGGGCGCGAGAGGCCATGAGGGTC
CGCCGCAAGGTCGACTACGGCACTCAAGGGCGAGTGAAAGACTCTTCTTCTCCGACGGATGGAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail