Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6740
Gene name
LocationContig_766:3831..5367
Strand-
Gene length (bp)1536
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02065 Melibiase Melibiase 2.8E-148 71 419
PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain 4.5E-22 2 64
PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain 4.0E-22 433 508

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 2 510 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 2 510 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 2 510 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 2 510 0.0E+00
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 2 510 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 2 510 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 2 510 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 2 510 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 2 510 0.0E+00
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 2 510 0.0E+00
sp|Q5ARP5|AGALG_EMENI Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglG PE=2 SV=1 2 510 0.0E+00
sp|Q0CEF5|AGALG_ASPTN Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglG PE=3 SV=1 2 510 0.0E+00
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 2 511 0.0E+00
sp|P43467|AGAL1_PEDPE Alpha-galactosidase 1 OS=Pediococcus pentosaceus GN=agaR PE=3 SV=1 2 485 3.0E-122
sp|P27756|AGAL_STRMU Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aga PE=3 SV=3 2 504 5.0E-119
sp|P43469|AGAL2_PEDPE Alpha-galactosidase 2 OS=Pediococcus pentosaceus GN=agaS PE=3 SV=1 2 508 1.0E-95
sp|P16551|RAFA_ECOLX Alpha-galactosidase OS=Escherichia coli GN=rafA PE=1 SV=1 2 477 2.0E-83
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH36 3.3E-193 2 493

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2424
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1559
Ophiocordyceps australis map64 (Brazil) OphauB2|4795
Ophiocordyceps camponoti-floridani Ophcf2|00511
Ophiocordyceps camponoti-rufipedis Ophun1|6740 (this protein)
Ophiocordyceps kimflemingae Ophio5|1234
Ophiocordyceps subramaniannii Hirsu2|3439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6740
MGYSSHLHNPFVALVDSTATESEGEAWGFSLVYTGSFTAEVEKGSQGSTRVVMGFNPSQLSWTLGPGETLVAPEV
VAVFSDTGIGGMSRKLHGLYRKHLMKSKYAVQPRPVLLNSWEGVHFDYDQAKIQKLAEQSASLGVKLFVLDDGWF
GREHPRVDDDAGLGDWEANPQRFPDGLKPLIENITSLRTGPLPSDAKLKFGLWFEPEMVNPNSTLYERHPDWALH
AGPYPRTERRHQLVLNLALPEVQEYIIDSVSRVLQGSRIEYVKWDNNRAMHELPSASTAHAYMLGMYHVMKTLTE
RFPDILWEGCASGGGRFDPGILQYFPQVWTSDDTDALERLHIQFGTSLAYPPSAMGAHVSAVPNGQTGRTAPVEF
RAHVAMMGGSFGLELDPGKMPAEDRAKVPGLIKLAEEVNPIVVGGHLWRLRLPGESNWPAALFVSDDGERAVLFY
FQLRAAVNQAWPRLRLQGLDAGARYRLDGNRTLSGATLMNKGVSYAFAGDFGSRIVQLERL*
Coding >Ophun1|6740
ATGGGCTACTCGTCGCATCTGCACAACCCCTTTGTCGCCCTCGTCGATTCAACAGCCACCGAGTCGGAGGGCGAG
GCCTGGGGCTTCTCCCTCGTATACACCGGCTCCTTCACCGCCGAGGTCGAAAAGGGCTCCCAGGGCTCGACGCGC
GTCGTCATGGGCTTCAACCCGTCACAGCTCTCGTGGACGCTCGGTCCGGGCGAGACGCTCGTCGCGCCAGAGGTC
GTCGCCGTCTTCTCCGACACCGGCATCGGCGGCATGTCGCGGAAGCTTCATGGCCTTTACCGGAAGCACCTGATG
AAGAGCAAGTATGCCGTGCAGCCACGTCCCGTCTTGCTCAACAGCTGGGAGGGCGTACACTTTGATTACGACCAG
GCCAAGATTCAGAAGCTCGCCGAGCAGTCTGCCAGCCTCGGCGTCAAGCTGTTCGTCCTCGACGACGGCTGGTTT
GGCCGGGAGCACCCCCGCGTCGACGATGATGCCGGCCTCGGCGACTGGGAGGCCAATCCGCAGAGGTTTCCCGAC
GGCCTCAAGCCGCTGATAGAAAACATCACGAGCCTCCGCACAGGGCCCTTGCCGTCGGATGCCAAGCTCAAGTTT
GGCCTGTGGTTCGAACCGGAGATGGTCAACCCCAACTCGACGCTGTACGAGAGGCATCCGGACTGGGCCCTCCAC
GCGGGACCTTATCCTCGCACCGAGAGGCGGCACCAGCTGGTGCTCAACCTTGCGCTGCCCGAGGTGCAAGAGTAC
ATCATCGACTCGGTGTCGAGGGTGCTCCAGGGGTCGCGCATCGAGTACGTCAAATGGGACAACAACAGGGCCATG
CACGAGCTGCCATCGGCCAGCACGGCTCACGCGTACATGTTGGGCATGTATCACGTCATGAAGACGCTGACGGAG
CGCTTCCCTGACATCCTGTGGGAGGGCTGCGCGTCGGGAGGCGGCCGCTTCGACCCCGGCATCCTGCAGTACTTT
CCGCAGGTGTGGACGTCAGATGACACGGACGCGCTGGAACGGCTGCACATCCAGTTCGGCACCTCGCTGGCCTAT
CCGCCGTCGGCCATGGGCGCTCACGTGTCGGCGGTGCCCAACGGGCAGACGGGACGGACGGCGCCGGTCGAGTTC
CGGGCCCACGTGGCCATGATGGGCGGGTCCTTTGGCCTGGAGCTGGATCCGGGCAAGATGCCGGCCGAGGACAGG
GCCAAGGTACCGGGGCTGATCAAGCTCGCCGAAGAGGTCAACCCCATCGTCGTCGGCGGGCACCTCTGGCGGTTG
AGGCTGCCGGGCGAGTCCAACTGGCCGGCGGCGCTGTTCGTGTCCGACGACGGCGAGCGAGCGGTGCTGTTCTAC
TTTCAGCTGCGGGCGGCCGTCAACCAGGCCTGGCCGAGGCTGCGGCTGCAGGGACTGGACGCCGGGGCGCGGTAC
CGGCTGGACGGCAACCGGACGCTGTCGGGAGCGACGCTCATGAACAAGGGCGTATCGTACGCCTTCGCGGGCGAC
TTTGGCAGCAGGATCGTCCAGCTGGAGAGGTTGTGA
Transcript >Ophun1|6740
ATGGGCTACTCGTCGCATCTGCACAACCCCTTTGTCGCCCTCGTCGATTCAACAGCCACCGAGTCGGAGGGCGAG
GCCTGGGGCTTCTCCCTCGTATACACCGGCTCCTTCACCGCCGAGGTCGAAAAGGGCTCCCAGGGCTCGACGCGC
GTCGTCATGGGCTTCAACCCGTCACAGCTCTCGTGGACGCTCGGTCCGGGCGAGACGCTCGTCGCGCCAGAGGTC
GTCGCCGTCTTCTCCGACACCGGCATCGGCGGCATGTCGCGGAAGCTTCATGGCCTTTACCGGAAGCACCTGATG
AAGAGCAAGTATGCCGTGCAGCCACGTCCCGTCTTGCTCAACAGCTGGGAGGGCGTACACTTTGATTACGACCAG
GCCAAGATTCAGAAGCTCGCCGAGCAGTCTGCCAGCCTCGGCGTCAAGCTGTTCGTCCTCGACGACGGCTGGTTT
GGCCGGGAGCACCCCCGCGTCGACGATGATGCCGGCCTCGGCGACTGGGAGGCCAATCCGCAGAGGTTTCCCGAC
GGCCTCAAGCCGCTGATAGAAAACATCACGAGCCTCCGCACAGGGCCCTTGCCGTCGGATGCCAAGCTCAAGTTT
GGCCTGTGGTTCGAACCGGAGATGGTCAACCCCAACTCGACGCTGTACGAGAGGCATCCGGACTGGGCCCTCCAC
GCGGGACCTTATCCTCGCACCGAGAGGCGGCACCAGCTGGTGCTCAACCTTGCGCTGCCCGAGGTGCAAGAGTAC
ATCATCGACTCGGTGTCGAGGGTGCTCCAGGGGTCGCGCATCGAGTACGTCAAATGGGACAACAACAGGGCCATG
CACGAGCTGCCATCGGCCAGCACGGCTCACGCGTACATGTTGGGCATGTATCACGTCATGAAGACGCTGACGGAG
CGCTTCCCTGACATCCTGTGGGAGGGCTGCGCGTCGGGAGGCGGCCGCTTCGACCCCGGCATCCTGCAGTACTTT
CCGCAGGTGTGGACGTCAGATGACACGGACGCGCTGGAACGGCTGCACATCCAGTTCGGCACCTCGCTGGCCTAT
CCGCCGTCGGCCATGGGCGCTCACGTGTCGGCGGTGCCCAACGGGCAGACGGGACGGACGGCGCCGGTCGAGTTC
CGGGCCCACGTGGCCATGATGGGCGGGTCCTTTGGCCTGGAGCTGGATCCGGGCAAGATGCCGGCCGAGGACAGG
GCCAAGGTACCGGGGCTGATCAAGCTCGCCGAAGAGGTCAACCCCATCGTCGTCGGCGGGCACCTCTGGCGGTTG
AGGCTGCCGGGCGAGTCCAACTGGCCGGCGGCGCTGTTCGTGTCCGACGACGGCGAGCGAGCGGTGCTGTTCTAC
TTTCAGCTGCGGGCGGCCGTCAACCAGGCCTGGCCGAGGCTGCGGCTGCAGGGACTGGACGCCGGGGCGCGGTAC
CGGCTGGACGGCAACCGGACGCTGTCGGGAGCGACGCTCATGAACAAGGGCGTATCGTACGCCTTCGCGGGCGAC
TTTGGCAGCAGGATCGTCCAGCTGGAGAGGTTGTGA
Gene >Ophun1|6740
ATGGGCTACTCGTCGCATCTGCACAACCCCTTTGTCGCCCTCGTCGATTCAACAGCCACCGAGTCGGAGGGCGAG
GCCTGGGGCTTCTCCCTCGTATACACCGGCTCCTTCACCGCCGAGGTCGAAAAGGGCTCCCAGGGCTCGACGCGC
GTCGTCATGGGCTTCAACCCGTCACAGCTCTCGTGGACGCTCGGTCCGGGCGAGACGCTCGTCGCGCCAGAGGTC
GTCGCCGTCTTCTCCGACACCGGCATCGGCGGCATGTCGCGGAAGCTTCATGGCCTTTACCGGAAGCACCTGATG
AAGAGCAAGTATGCCGTGCAGCCACGTCCCGTCTTGCTCAACAGCTGGGAGGGCGTACACTTTGATTACGACCAG
GCCAAGATTCAGAAGCTCGCCGAGCAGTCTGCCAGCCTCGGCGTCAAGCTGTTCGTCCTCGACGACGGCTGGTTT
GGCCGGGAGCACCCCCGCGTCGACGATGATGCCGGCCTCGGCGACTGGGAGGCCAATCCGCAGAGGTTTCCCGAC
GGCCTCAAGCCGCTGATAGAAAACATCACGAGCCTCCGCACAGGGCCCTTGCCGTCGGATGCCAAGCTCAAGTTT
GGCCTGTGGTTCGAACCGGAGATGGTCAACCCCAACTCGACGCTGTACGAGAGGCATCCGGACTGGGCCCTCCAC
GCGGGACCTTATCCTCGCACCGAGAGGCGGCACCAGCTGGTGCTCAACCTTGCGCTGCCCGAGGTGCAAGAGTAC
ATCATCGACTCGGTGTCGAGGGTGCTCCAGGGGTCGCGCATCGAGTACGTCAAATGGGACAACAACAGGGCCATG
CACGAGCTGCCATCGGCCAGCACGGCTCACGCGTACATGTTGGGCATGTATCACGTCATGAAGACGCTGACGGAG
CGCTTCCCTGACATCCTGTGGGAGGGCTGCGCGTCGGGAGGCGGCCGCTTCGACCCCGGCATCCTGCAGTACTTT
CCGCAGGTGTGGACGTCAGATGACACGGACGCGCTGGAACGGCTGCACATCCAGTTCGGCACCTCGCTGGCCTAT
CCGCCGTCGGCCATGGGCGCTCACGTGTCGGCGGTGCCCAACGGGCAGACGGGACGGACGGCGCCGGTCGAGTTC
CGGGCCCACGTGGCCATGATGGGCGGGTCCTTTGGCCTGGAGCTGGATCCGGGCAAGATGCCGGCCGAGGACAGG
GCCAAGGTACCGGGGCTGATCAAGCTCGCCGAAGAGGTCAACCCCATCGTCGTCGGCGGGCACCTCTGGCGGTTG
AGGCTGCCGGGCGAGTCCAACTGGCCGGCGGCGCTGTTCGTGTCCGACGACGGCGAGCGAGCGGTGCTGTTCTAC
TTTCAGCTGCGGGCGGCCGTCAACCAGGCCTGGCCGAGGCTGCGGCTGCAGGGACTGGACGCCGGGGCGCGGTAC
CGGCTGGACGGCAACCGGACGCTGTCGGGAGCGACGCTCATGAACAAGGGCGTATCGTACGCCTTCGCGGGCGAC
TTTGGCAGCAGGATCGTCCAGCTGGAGAGGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail