Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6739
Gene name
LocationContig_766:322..2747
Strand-
Gene length (bp)2425
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 1.5E-01 219 243
PF13516 LRR_6 Leucine Rich repeat 2.0E+00 328 348
PF13516 LRR_6 Leucine Rich repeat 1.3E-02 378 400
PF12937 F-box-like F-box-like 8.2E-12 75 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 40 558 0.0E+00
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 74 554 2.0E-99
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 76 554 8.0E-58
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 75 448 3.0E-34
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 75 448 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 40 558 0.0E+00
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 74 554 2.0E-99
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 76 554 8.0E-58
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 75 448 3.0E-34
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 75 448 5.0E-34
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 75 448 5.0E-34
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 75 448 5.0E-34
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 76 448 1.0E-33
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 75 461 1.0E-33
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 76 448 2.0E-33
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 72 427 1.0E-30
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 72 427 2.0E-30
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 65 460 6.0E-29
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 9 456 5.0E-28
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 74 456 7.0E-28
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 197 497 1.0E-27
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 74 427 4.0E-27
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 171 448 8.0E-25
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 220 452 1.0E-24
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 171 448 2.0E-24
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 171 448 2.0E-24
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 168 510 6.0E-23
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 163 510 2.0E-22
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 154 504 6.0E-22
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 145 410 1.0E-21
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 163 510 3.0E-21
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 163 510 9.0E-21
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 163 510 1.0E-20
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 66 511 1.0E-20
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 61 366 6.0E-20
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 74 514 7.0E-20
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 74 511 3.0E-19
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 170 509 6.0E-19
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 223 504 9.0E-19
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 61 376 2.0E-18
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 168 456 8.0E-18
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 76 323 8.0E-18
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 248 510 2.0E-17
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 248 510 2.0E-17
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 248 510 3.0E-17
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 248 527 7.0E-17
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 248 527 7.0E-17
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 168 452 2.0E-16
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 171 427 3.0E-16
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 173 378 4.0E-16
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 223 427 1.0E-15
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 171 432 1.0E-15
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 248 527 3.0E-15
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 170 375 3.0E-15
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 189 378 3.0E-15
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 248 504 6.0E-15
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 248 527 1.0E-14
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 248 527 1.0E-14
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 248 527 2.0E-14
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 110 376 3.0E-14
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 168 513 4.0E-14
sp|Q0VD31|FBXL4_BOVIN F-box/LRR-repeat protein 4 OS=Bos taurus GN=FBXL4 PE=2 SV=1 148 432 4.0E-14
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 185 376 4.0E-14
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 185 392 4.0E-14
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 185 376 5.0E-14
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 185 376 5.0E-14
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 173 378 6.0E-14
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 154 447 7.0E-14
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 166 403 1.0E-13
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 293 514 1.0E-13
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 174 376 1.0E-13
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 171 528 2.0E-13
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 207 423 2.0E-13
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 171 403 3.0E-13
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 223 426 3.0E-13
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 174 376 4.0E-13
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 141 377 8.0E-13
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 159 402 9.0E-13
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 141 377 1.0E-12
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 141 377 1.0E-12
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 332 545 1.0E-12
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 223 426 2.0E-12
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 72 446 2.0E-12
sp|Q8BH70|FBXL4_MOUSE F-box/LRR-repeat protein 4 OS=Mus musculus GN=Fbxl4 PE=1 SV=1 148 432 2.0E-12
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 72 446 2.0E-12
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 118 265 3.0E-12
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 163 408 4.0E-12
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 223 426 5.0E-12
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 171 482 6.0E-12
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 134 427 7.0E-12
sp|Q9UKA2|FBXL4_HUMAN F-box/LRR-repeat protein 4 OS=Homo sapiens GN=FBXL4 PE=1 SV=2 148 432 7.0E-12
sp|Q0P4D1|AMN1_DANRE Protein AMN1 homolog OS=Danio rerio GN=amn1 PE=2 SV=1 148 377 9.0E-12
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 298 521 1.0E-11
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 156 452 1.0E-11
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 248 515 3.0E-11
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 139 265 4.0E-11
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 181 445 4.0E-11
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 118 265 5.0E-11
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 223 426 6.0E-11
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 219 377 7.0E-11
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 168 265 1.0E-10
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 170 286 2.0E-10
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 205 445 2.0E-10
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 171 368 2.0E-10
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 182 398 2.0E-10
sp|Q3EC97|FBL14_ARATH F-box/LRR-repeat protein 14 OS=Arabidopsis thaliana GN=FBL14 PE=2 SV=1 184 533 2.0E-10
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 130 265 3.0E-10
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 323 539 4.0E-10
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 185 523 5.0E-10
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 148 317 5.0E-10
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 135 377 7.0E-10
sp|Q9SRR1|FBL12_ARATH F-box/LRR-repeat protein 12 OS=Arabidopsis thaliana GN=FBL12 PE=2 SV=1 67 428 1.0E-09
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 167 315 2.0E-09
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 170 383 2.0E-09
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 247 423 3.0E-09
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 170 427 4.0E-09
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 325 539 4.0E-09
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 236 509 5.0E-09
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 170 297 5.0E-09
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 137 294 5.0E-09
sp|Q32L08|AMN1_BOVIN Protein AMN1 homolog OS=Bos taurus GN=AMN1 PE=2 SV=2 325 539 5.0E-09
sp|Q9ZWC6|ATB_ARATH F-box protein At-B OS=Arabidopsis thaliana GN=ATB PE=2 SV=1 206 452 5.0E-09
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 247 509 6.0E-09
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 223 412 7.0E-09
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 137 294 8.0E-09
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 156 521 9.0E-09
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 132 325 1.0E-08
sp|Q9FGN3|FB290_ARATH F-box protein At5g51380 OS=Arabidopsis thaliana GN=At5g51380 PE=2 SV=1 182 461 1.0E-08
sp|Q13309|SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens GN=SKP2 PE=1 SV=2 77 375 1.0E-08
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 233 423 2.0E-08
sp|Q32L08|AMN1_BOVIN Protein AMN1 homolog OS=Bos taurus GN=AMN1 PE=2 SV=2 219 368 2.0E-08
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 320 539 3.0E-08
sp|Q8VYT5|FB254_ARATH F-box protein At5g07670 OS=Arabidopsis thaliana GN=At5g07670 PE=2 SV=1 182 371 3.0E-08
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 134 325 4.0E-08
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 145 313 6.0E-08
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 168 371 8.0E-08
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 145 313 9.0E-08
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 145 313 9.0E-08
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 141 275 9.0E-08
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 171 363 1.0E-07
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 168 294 1.0E-07
sp|Q9S9X4|FBL8_ARATH Putative F-box/LRR-repeat protein 8 OS=Arabidopsis thaliana GN=FBL8 PE=3 SV=1 182 286 1.0E-07
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 145 317 2.0E-07
sp|Q8VYT5|FB254_ARATH F-box protein At5g07670 OS=Arabidopsis thaliana GN=At5g07670 PE=2 SV=1 168 423 2.0E-07
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 293 461 3.0E-07
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 355 525 4.0E-07
sp|Q9ZWC6|ATB_ARATH F-box protein At-B OS=Arabidopsis thaliana GN=ATB PE=2 SV=1 182 427 4.0E-07
sp|Q9FGN3|FB290_ARATH F-box protein At5g51380 OS=Arabidopsis thaliana GN=At5g51380 PE=2 SV=1 148 383 4.0E-07
sp|Q9SDA8|FBL10_ARATH F-box/LRR-repeat protein 10 OS=Arabidopsis thaliana GN=FBL10 PE=2 SV=1 339 509 4.0E-07
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 308 461 5.0E-07
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 226 467 5.0E-07
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 168 298 9.0E-07
sp|Q0P4D1|AMN1_DANRE Protein AMN1 homolog OS=Danio rerio GN=amn1 PE=2 SV=1 145 294 9.0E-07
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 326 517 1.0E-06
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 326 514 1.0E-06
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 168 298 1.0E-06
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 168 298 1.0E-06
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 169 545 1.0E-06
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 339 509 2.0E-06
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 292 462 2.0E-06
sp|Q9S9X4|FBL8_ARATH Putative F-box/LRR-repeat protein 8 OS=Arabidopsis thaliana GN=FBL8 PE=3 SV=1 27 429 2.0E-06
sp|Q9SDA8|FBL10_ARATH F-box/LRR-repeat protein 10 OS=Arabidopsis thaliana GN=FBL10 PE=2 SV=1 156 472 2.0E-06
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 343 528 3.0E-06
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 168 298 3.0E-06
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 292 494 3.0E-06
sp|Q9M096|FBL19_ARATH Putative F-box/LRR-repeat protein 19 OS=Arabidopsis thaliana GN=FBL19 PE=4 SV=1 71 255 3.0E-06
sp|Q9SN10|FBL16_ARATH F-box/LRR-repeat protein 16 OS=Arabidopsis thaliana GN=FBL16 PE=2 SV=1 33 452 3.0E-06
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 320 509 5.0E-06
sp|Q8WV35|LRC29_HUMAN Leucine-rich repeat-containing protein 29 OS=Homo sapiens GN=LRRC29 PE=1 SV=1 329 423 5.0E-06
sp|Q9FH99|FB302_ARATH F-box protein At5g67140 OS=Arabidopsis thaliana GN=At5g67140 PE=2 SV=1 74 254 5.0E-06
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 343 528 6.0E-06
sp|Q5VMP0|MAX2_ORYSJ F-box/LRR-repeat MAX2 homolog OS=Oryza sativa subsp. japonica GN=D3 PE=2 SV=2 190 452 6.0E-06
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 168 275 7.0E-06
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 168 275 7.0E-06
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 168 275 7.0E-06
sp|Q3EC97|FBL14_ARATH F-box/LRR-repeat protein 14 OS=Arabidopsis thaliana GN=FBL14 PE=2 SV=1 168 375 7.0E-06
sp|Q6CVS2|AMN1_KLULA Antagonist of mitotic exit network protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AMN1 PE=3 SV=1 165 328 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6739
MLPAAAVPSASSATRPASSPEEQDDSRSSSSATSPAPPDNEESDFFFGANDSQSSLGVPNFQDMQVDDTCWPPVN
RLPNEILIGIFAKLSSPADLYHCLLVSRRWARNAVDLLWHRPACTSWRNHSIICQTLGLPRPFFNYSDFIKRLNL
ASLAEKVNDGSVMPLAICSRVERLTLTNCRGLTDSGLIALVENSASLQALDISNDKNITEQSIRAIAEHCRRLQG
LNISGCDAISNESMIALAESCKYIKRLKLNECAQLRDDAILAFADHCPNILEIDLHQCNAIGNGPVTALLSKGSC
LRELRLACCELIDDSAFLGLPENQVYEHLRILDLTSCVRLTDAAVDKIIEVAPRLRNLVLAKCRNITDAAVHSIA
KLNKNLHYVHLGHCALITDDGVKKLVNSCNRIRYIDLGCCTNLTDESVKRLALLPKLKRIGLVKCSSITDESVFA
LAEAAYRPRVRKDPNGVYVGGEYYASSLERVHLSYCVNLTLKSIMRLLNSCPRLTHLSLTGVAAFQREDFQVFCR
HAPPEFTQHQRDVFCVFSGSMVSQFREFLNTSARFEELRESLPFRAGGSRIRGAAARRSQAMANNLQLTEGEGFD
DEMADEDQDFAALEGHEMAVDAHHVQNQPPPPASAFQPAPMGAPVPLSAPNPGQHPFASSSTHAHPANEPDVDPS
QWDAALNSISIGSFPQLNNSQGQTPALVAALAPEFGLGPSQPASSAALGGSTPGASTAPMQQPRQDPSDE*
Coding >Ophun1|6739
ATGCTACCGGCCGCTGCTGTCCCCAGCGCCTCTTCGGCCACGAGACCGGCCTCATCTCCAGAAGAGCAAGATGAC
TCCCGATCCTCATCGTCGGCCACGTCTCCCGCGCCGCCCGACAACGAAGAATCCGACTTCTTCTTCGGGGCCAAC
GACTCGCAGTCGTCGCTCGGCGTCCCCAATTTCCAAGATATGCAGGTCGACGACACCTGCTGGCCGCCCGTCAAC
CGGCTGCCCAACGAGATCCTCATCGGCATCTTCGCCAAGCTGAGCTCCCCGGCCGACTTGTACCACTGCCTGCTC
GTCTCCCGCCGCTGGGCACGCAACGCCGTCGATTTACTGTGGCACAGGCCCGCCTGTACCAGCTGGCGGAACCAT
AGCATCATCTGCCAGACGCTTGGACTCCCGCGGCCCTTCTTCAACTACTCTGACTTCATCAAACGTCTCAACCTC
GCCTCGCTCGCCGAAAAGGTCAATGATGGCAGCGTCATGCCCCTGGCCATCTGCTCCCGCGTCGAGAGGCTGACG
CTGACCAACTGCCGCGGCCTCACCGACTCGGGCCTCATCGCTCTCGTCGAGAACAGCGCCTCCCTCCAGGCGCTC
GACATCTCCAACGACAAGAACATCACCGAGCAGTCCATCCGCGCCATCGCCGAGCACTGCCGTCGTCTGCAAGGC
CTCAACATCTCGGGCTGCGATGCCATCTCCAACGAGAGCATGATTGCCCTGGCCGAGAGCTGCAAATACATCAAG
AGGCTGAAACTCAACGAATGCGCCCAACTGCGCGACGATGCCATCCTCGCCTTTGCCGACCACTGCCCCAATATC
CTCGAGATTGATCTGCACCAGTGCAACGCCATCGGCAACGGGCCCGTCACCGCCCTCCTGTCCAAGGGGAGCTGC
CTCCGCGAGCTGCGTCTCGCCTGCTGTGAACTCATCGACGACTCCGCCTTCTTGGGCCTGCCGGAGAACCAAGTC
TATGAGCATCTGCGCATCCTCGACCTGACGTCGTGCGTCAGGCTCACCGACGCCGCCGTTGACAAGATCATCGAG
GTGGCCCCTCGCCTCCGCAACCTGGTCCTGGCCAAATGTCGCAACATCACGGACGCGGCCGTCCACTCCATCGCG
AAGCTGAACAAGAACCTGCACTACGTCCATCTCGGCCACTGCGCCCTCATCACCGACGACGGCGTCAAGAAGCTC
GTCAACTCGTGCAACCGCATCAGATACATTGACCTCGGCTGCTGCACCAACCTCACCGACGAGTCCGTCAAGCGG
CTGGCTCTCCTTCCCAAGCTCAAGCGCATCGGCCTCGTCAAGTGCAGTTCCATCACGGATGAGTCCGTCTTCGCC
CTCGCCGAGGCCGCCTACCGCCCTCGTGTGAGGAAAGACCCTAATGGAGTCTACGTCGGTGGAGAGTATTACGCC
TCGAGCCTCGAGCGCGTCCACCTGAGTTACTGCGTCAACCTGACGCTCAAGAGCATCATGCGCCTCCTCAACTCG
TGCCCCCGCCTCACCCATCTGAGCCTCACAGGCGTGGCCGCTTTCCAGCGTGAAGACTTTCAAGTATTTTGCCGT
CACGCGCCTCCCGAGTTCACGCAGCACCAGCGAGACGTATTCTGCGTCTTTTCCGGAAGCATGGTCTCACAGTTC
CGCGAGTTCCTCAACACGTCTGCTCGCTTCGAGGAGCTTCGAGAGAGCCTTCCATTCCGTGCCGGAGGCAGCAGG
ATCCGAGGTGCCGCCGCGCGAAGGTCTCAAGCCATGGCCAATAACTTACAACTGACGGAAGGCGAAGGCTTCGAT
GACGAGATGGCCGACGAGGACCAAGACTTTGCCGCCCTGGAGGGCCACGAGATGGCGGTGGATGCCCACCACGTC
CAGAACCAGCCGCCACCCCCGGCTTCGGCCTTCCAGCCCGCGCCTATGGGCGCTCCCGTGCCGTTGTCGGCTCCG
AACCCGGGACAGCACCCGTTCGCTTCCTCCTCGACACACGCGCACCCCGCGAACGAGCCCGACGTCGATCCGAGC
CAGTGGGACGCGGCCCTCAATTCGATATCCATCGGCTCGTTCCCGCAGCTCAACAACTCCCAGGGCCAGACGCCA
GCCCTCGTCGCCGCCCTGGCCCCTGAGTTTGGGCTGGGCCCGTCTCAGCCGGCCAGCTCGGCAGCGCTTGGGGGC
TCGACGCCTGGAGCGAGCACTGCGCCTATGCAGCAGCCGCGCCAGGATCCGTCGGATGAATGA
Transcript >Ophun1|6739
ATGCTACCGGCCGCTGCTGTCCCCAGCGCCTCTTCGGCCACGAGACCGGCCTCATCTCCAGAAGAGCAAGATGAC
TCCCGATCCTCATCGTCGGCCACGTCTCCCGCGCCGCCCGACAACGAAGAATCCGACTTCTTCTTCGGGGCCAAC
GACTCGCAGTCGTCGCTCGGCGTCCCCAATTTCCAAGATATGCAGGTCGACGACACCTGCTGGCCGCCCGTCAAC
CGGCTGCCCAACGAGATCCTCATCGGCATCTTCGCCAAGCTGAGCTCCCCGGCCGACTTGTACCACTGCCTGCTC
GTCTCCCGCCGCTGGGCACGCAACGCCGTCGATTTACTGTGGCACAGGCCCGCCTGTACCAGCTGGCGGAACCAT
AGCATCATCTGCCAGACGCTTGGACTCCCGCGGCCCTTCTTCAACTACTCTGACTTCATCAAACGTCTCAACCTC
GCCTCGCTCGCCGAAAAGGTCAATGATGGCAGCGTCATGCCCCTGGCCATCTGCTCCCGCGTCGAGAGGCTGACG
CTGACCAACTGCCGCGGCCTCACCGACTCGGGCCTCATCGCTCTCGTCGAGAACAGCGCCTCCCTCCAGGCGCTC
GACATCTCCAACGACAAGAACATCACCGAGCAGTCCATCCGCGCCATCGCCGAGCACTGCCGTCGTCTGCAAGGC
CTCAACATCTCGGGCTGCGATGCCATCTCCAACGAGAGCATGATTGCCCTGGCCGAGAGCTGCAAATACATCAAG
AGGCTGAAACTCAACGAATGCGCCCAACTGCGCGACGATGCCATCCTCGCCTTTGCCGACCACTGCCCCAATATC
CTCGAGATTGATCTGCACCAGTGCAACGCCATCGGCAACGGGCCCGTCACCGCCCTCCTGTCCAAGGGGAGCTGC
CTCCGCGAGCTGCGTCTCGCCTGCTGTGAACTCATCGACGACTCCGCCTTCTTGGGCCTGCCGGAGAACCAAGTC
TATGAGCATCTGCGCATCCTCGACCTGACGTCGTGCGTCAGGCTCACCGACGCCGCCGTTGACAAGATCATCGAG
GTGGCCCCTCGCCTCCGCAACCTGGTCCTGGCCAAATGTCGCAACATCACGGACGCGGCCGTCCACTCCATCGCG
AAGCTGAACAAGAACCTGCACTACGTCCATCTCGGCCACTGCGCCCTCATCACCGACGACGGCGTCAAGAAGCTC
GTCAACTCGTGCAACCGCATCAGATACATTGACCTCGGCTGCTGCACCAACCTCACCGACGAGTCCGTCAAGCGG
CTGGCTCTCCTTCCCAAGCTCAAGCGCATCGGCCTCGTCAAGTGCAGTTCCATCACGGATGAGTCCGTCTTCGCC
CTCGCCGAGGCCGCCTACCGCCCTCGTGTGAGGAAAGACCCTAATGGAGTCTACGTCGGTGGAGAGTATTACGCC
TCGAGCCTCGAGCGCGTCCACCTGAGTTACTGCGTCAACCTGACGCTCAAGAGCATCATGCGCCTCCTCAACTCG
TGCCCCCGCCTCACCCATCTGAGCCTCACAGGCGTGGCCGCTTTCCAGCGTGAAGACTTTCAAGTATTTTGCCGT
CACGCGCCTCCCGAGTTCACGCAGCACCAGCGAGACGTATTCTGCGTCTTTTCCGGAAGCATGGTCTCACAGTTC
CGCGAGTTCCTCAACACGTCTGCTCGCTTCGAGGAGCTTCGAGAGAGCCTTCCATTCCGTGCCGGAGGCAGCAGG
ATCCGAGGTGCCGCCGCGCGAAGGTCTCAAGCCATGGCCAATAACTTACAACTGACGGAAGGCGAAGGCTTCGAT
GACGAGATGGCCGACGAGGACCAAGACTTTGCCGCCCTGGAGGGCCACGAGATGGCGGTGGATGCCCACCACGTC
CAGAACCAGCCGCCACCCCCGGCTTCGGCCTTCCAGCCCGCGCCTATGGGCGCTCCCGTGCCGTTGTCGGCTCCG
AACCCGGGACAGCACCCGTTCGCTTCCTCCTCGACACACGCGCACCCCGCGAACGAGCCCGACGTCGATCCGAGC
CAGTGGGACGCGGCCCTCAATTCGATATCCATCGGCTCGTTCCCGCAGCTCAACAACTCCCAGGGCCAGACGCCA
GCCCTCGTCGCCGCCCTGGCCCCTGAGTTTGGGCTGGGCCCGTCTCAGCCGGCCAGCTCGGCAGCGCTTGGGGGC
TCGACGCCTGGAGCGAGCACTGCGCCTATGCAGCAGCCGCGCCAGGATCCGTCGGATGAATGA
Gene >Ophun1|6739
ATGCTACCGGCCGCTGCTGTCCCCAGCGCCTCTTCGGCCACGAGACCGGCCTCATCTCCAGAAGAGCAAGATGAC
TCCCGATCCTCATCGTCGGCCACGTCTCCCGCGCCGCCCGACAACGAAGAATCCGACTTCTTCTTCGGGGCCAAC
GACTCGCAGTCGTCGCTCGGCGTCCCCAATTTCCAAGATATGCAGGTCGACGACACCTGCTGGCCGCCCGTCAAC
CGGCTGCCCAACGAGATCCTCATCGGCATCTTCGCCAAGCTGAGCTCCCCGGCCGACTTGTACCACTGCCTGCTC
GTCTCCCGCCGCTGGGCACGCAACGCCGTCGATTTACTGTGGCACAGGCCCGCCTGTACCAGCTGGCGGAACCAT
AGCATCATCTGCCAGACGCTTGGACTCCCGCGGCCCTTCTTCAACTACTCTGACTTCATCAAACGTCTCAACCTC
GCCTCGCTCGCCGAAAAGGTCAATGATGGCAGCGTCATGCCCCTGGCCATCTGCTCCCGCGTCGAGAGGCTGACG
CTGACCAACTGCCGCGGCCTCACCGACTCGGGCCTCATCGCTCTCGTCGAGAACAGCGCCTCCCTCCAGGCGCTC
GACATCTCCAACGACAAGAACATCACCGAGCAGTCCATCCGCGCCATCGCCGAGCACTGCCGTCGTCTGCAAGGC
CTCAACATCTCGGGCTGCGATGCCATCTCCAACGAGAGCATGATTGCCCTGGCCGAGAGCTGCAAATACATCAAG
AGGGTGAGAGCACCGTCGCCGCCATATGGGAACTAGCCTTGCTGACCCCCTCGTCCCCGGGACTAGCTGAAACTC
AACGAATGCGCCCAACTGCGCGACGATGCCATCCTCGCCTTTGCCGACCACTGCCCCAATATCCTCGAGATTGAT
CTGCACCAGTGCAACGCCATCGGCAACGGGCCCGTCACCGCCCTCCTGTCCAAGGGGAGCTGCCTCCGCGAGCTG
CGTCTCGCCTGCTGTGAACTCATCGACGACTCCGCCTTCTTGGGCCTGCCGGAGAACCAAGTCTATGAGCATCTG
CGCATCCTCGACCTGACGTCGTGCGTCAGGCTCACCGACGCCGCCGTTGACAAGATCATCGAGGTGGCCCCTCGC
CTCCGCAACCTGGTCCTGGCCAAATGTCGCAACATCACGGACGCGGCCGTCCACTCCATCGCGAAGCTGAACAAG
AACCTGCACTACGTCCATCTCGGCCACTGCGCCCTCATCACCGACGACGGCGTCAAGAAGCTCGTCAACTCGTGC
AACCGCATCAGATACATTGACCTCGGCTGCTGCACCAACCTCACCGACGAGTCCGTCAAGCGGCTGGCTCTCCTT
CCCAAGCTCAAGCGCATCGGCCTCGTCAAGTGCAGTTCCATCACGGATGAGTCCGTCTTCGCCCTCGCCGAGGCC
GCCTACCGCCCTCGTGTGAGGAAAGACCCTAATGGAGTCTACGTCGGTGGAGAGTATTACGCCTCGAGCCTCGAG
CGCGTCCACCTGAGTTACTGCGTCAACCTGACGCTCAAGGTGAGCCTACGGAGCCTCTGCCGGTCTTGTCACGCC
CCTGCTGACGACGGAGCCCAGAGCATCATGCGCCTCCTCAACTCGTGCCCCCGCCTCACCCATCTGAGCCTCACA
GGCGTGGCCGCTTTCCAGCGTGAAGACTTTCAAGTATTTTGCCGTCACGCGCCTCCCGGTTAGTGCAGGTCCCGC
GGCGACCGACCCCCGTGAGGCTCCCGGCCGCTGACGTATGTGGCGTGCAGAGTTCACGCAGCACCAGCGAGACGT
ATTCTGCGTCTTTTCCGGAAGCATGGTCTCACAGTTCCGCGAGTTCCTCAACACGTCTGCTCGCTTCGAGGAGCT
TCGAGAGAGCCTTCCATTCCGTGCCGGAGGCAGCAGGATCCGAGGTGCCGCCGCGCGAAGGTCTCAAGCCATGGC
CAATAACTTACAACTGACGGAAGGCGAAGGCTTCGATGACGAGATGGCCGACGAGGACCAAGACTTTGCCGCCCT
GGAGGGCCACGAGATGGCGGTGGATGCCCACCACGTCCAGAACCAGCCGCCACCCCCGGCTTCGGCCTTCCAGCC
CGCGCCTATGGGCGCTCCCGTGCCGTTGTCGGCTCCGAACCCGGGACAGCACCCGTTCGCTTCCTCCTCGACACA
CGCGCACCCCGCGAACGAGCCCGACGTCGATCCGAGCCAGTGGGACGCGGCCCTCAATTCGATATCCATCGGCTC
GTTCCCGCAGCTCAACAACTCCCAGGGCCAGACGCCAGCCCTCGTCGCCGCCCTGGCCCCTGAGTTTGGGCTGGG
CCCGTCTCAGCCGGCCAGCTCGGCAGCGCTTGGGGGCTCGACGCCTGGAGCGAGCACTGCGCCTATGCAGCAGCC
GCGCCAGGATCCGTCGGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail