Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6732
Gene name
LocationContig_763:394..1494
Strand+
Gene length (bp)1100
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase 1.7E-55 5 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2AAJ5|3HAO_PODAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=BNA1 PE=3 SV=1 7 190 2.0E-84
sp|Q7SDX3|3HAO_NEUCR 3-hydroxyanthranilate 3,4-dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bna1 PE=3 SV=1 15 188 2.0E-83
sp|Q2HD63|3HAO_CHAGB 3-hydroxyanthranilate 3,4-dioxygenase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BNA1 PE=3 SV=1 15 188 1.0E-82
sp|A4REV8|3HAO_MAGO7 3-hydroxyanthranilate 3,4-dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=BNA1 PE=3 SV=1 15 187 8.0E-81
sp|A3LP72|3HAO_PICST 3-hydroxyanthranilate 3,4-dioxygenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA1 PE=3 SV=1 9 178 3.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2AAJ5|3HAO_PODAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=BNA1 PE=3 SV=1 7 190 2.0E-84
sp|Q7SDX3|3HAO_NEUCR 3-hydroxyanthranilate 3,4-dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bna1 PE=3 SV=1 15 188 2.0E-83
sp|Q2HD63|3HAO_CHAGB 3-hydroxyanthranilate 3,4-dioxygenase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BNA1 PE=3 SV=1 15 188 1.0E-82
sp|A4REV8|3HAO_MAGO7 3-hydroxyanthranilate 3,4-dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=BNA1 PE=3 SV=1 15 187 8.0E-81
sp|A3LP72|3HAO_PICST 3-hydroxyanthranilate 3,4-dioxygenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA1 PE=3 SV=1 9 178 3.0E-65
sp|Q1E5I0|3HAO_COCIM 3-hydroxyanthranilate 3,4-dioxygenase OS=Coccidioides immitis (strain RS) GN=BNA1 PE=3 SV=1 9 170 4.0E-65
sp|A1C408|3HAO1_ASPCL 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna1-1 PE=3 SV=1 9 186 4.0E-64
sp|Q2UHT9|3HAO1_ASPOR 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna1-1 PE=3 SV=1 9 186 1.0E-63
sp|Q4WCF1|3HAO1_ASPFU 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna1-1 PE=3 SV=1 9 186 1.0E-63
sp|B0Y9Z9|3HAO1_ASPFC 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna1-1 PE=3 SV=1 9 186 1.0E-63
sp|A1DB76|3HAO_NEOFI 3-hydroxyanthranilate 3,4-dioxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bna1 PE=3 SV=1 9 186 3.0E-63
sp|Q6CFX1|3HAO_YARLI 3-hydroxyanthranilate 3,4-dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BNA1 PE=3 SV=1 6 178 4.0E-63
sp|Q59K86|3HAO_CANAL 3-hydroxyanthranilate 3,4-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA1 PE=3 SV=1 7 176 1.0E-62
sp|A2R8S7|3HAO_ASPNC 3-hydroxyanthranilate 3,4-dioxygenase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bna1 PE=3 SV=1 9 186 2.0E-62
sp|P47096|3HAO_YEAST 3-hydroxyanthranilate 3,4-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA1 PE=1 SV=1 9 178 3.0E-62
sp|A5E0Z9|3HAO_LODEL 3-hydroxyanthranilate 3,4-dioxygenase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=BNA1 PE=3 SV=1 9 183 1.0E-60
sp|Q0D1U6|3HAO_ASPTN 3-hydroxyanthranilate 3,4-dioxygenase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bna1 PE=3 SV=2 9 192 2.0E-60
sp|A5DLW3|3HAO_PICGU 3-hydroxyanthranilate 3,4-dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA1 PE=3 SV=2 9 178 2.0E-59
sp|Q75CP6|3HAO_ASHGO 3-hydroxyanthranilate 3,4-dioxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA1 PE=3 SV=1 9 178 9.0E-59
sp|A1C874|3HAO2_ASPCL 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna1-2 PE=3 SV=2 15 175 1.0E-54
sp|Q2UB88|3HAO2_ASPOR 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna1-2 PE=3 SV=1 13 175 6.0E-53
sp|P0CL86|3HAO_CRYNJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BNA1 PE=3 SV=1 15 174 2.0E-52
sp|P0CL87|3HAO_CRYNB 3-hydroxyanthranilate 3,4-dioxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BNA1 PE=3 SV=1 15 174 2.0E-52
sp|Q4WZC3|3HAO2_ASPFU 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna1-2 PE=3 SV=2 15 175 4.0E-52
sp|B0XVP0|3HAO2_ASPFC 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna1-2 PE=3 SV=2 15 175 4.0E-52
sp|Q4P2Q7|3HAO_USTMA 3-hydroxyanthranilate 3,4-dioxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BNA1 PE=3 SV=1 9 170 2.0E-51
sp|Q54S02|3HAO_DICDI 3-hydroxyanthranilate 3,4-dioxygenase OS=Dictyostelium discoideum GN=haao PE=3 SV=1 9 174 8.0E-41
sp|Q3BV37|3HAO_XANC5 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nbaC PE=3 SV=1 9 173 2.0E-39
sp|Q5H043|3HAO_XANOR 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nbaC PE=3 SV=2 9 173 3.0E-39
sp|Q2P320|3HAO_XANOM 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nbaC PE=3 SV=2 9 173 3.0E-39
sp|Q8PM31|3HAO_XANAC 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nbaC PE=3 SV=1 9 173 2.0E-38
sp|Q0VCA8|3HAO_BOVIN 3-hydroxyanthranilate 3,4-dioxygenase OS=Bos taurus GN=HAAO PE=1 SV=1 9 166 4.0E-38
sp|Q8PAD0|3HAO_XANCP 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nbaC PE=3 SV=1 9 170 6.0E-38
sp|Q4UT95|3HAO_XANC8 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nbaC PE=3 SV=1 9 170 6.0E-38
sp|P46953|3HAO_RAT 3-hydroxyanthranilate 3,4-dioxygenase OS=Rattus norvegicus GN=Haao PE=1 SV=2 9 166 6.0E-38
sp|Q78JT3|3HAO_MOUSE 3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus GN=Haao PE=1 SV=1 6 180 8.0E-38
sp|B0RUZ7|3HAO_XANCB 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=nbaC PE=3 SV=1 9 170 1.0E-37
sp|P46952|3HAO_HUMAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Homo sapiens GN=HAAO PE=1 SV=2 6 166 1.0E-37
sp|A7RIT9|3HAO_NEMVE 3-hydroxyanthranilate 3,4-dioxygenase OS=Nematostella vectensis GN=v1g178517 PE=3 SV=1 15 166 2.0E-36
sp|Q6DIZ0|3HAO_XENTR 3-hydroxyanthranilate 3,4-dioxygenase OS=Xenopus tropicalis GN=haao PE=2 SV=1 11 184 1.0E-35
sp|Q28SE8|3HAO_JANSC 3-hydroxyanthranilate 3,4-dioxygenase OS=Jannaschia sp. (strain CCS1) GN=nbaC PE=3 SV=1 3 180 1.0E-34
sp|Q6P7I0|3HAO_XENLA 3-hydroxyanthranilate 3,4-dioxygenase OS=Xenopus laevis GN=haao PE=2 SV=1 9 166 3.0E-34
sp|B1KJM7|3HAO_SHEWM 3-hydroxyanthranilate 3,4-dioxygenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nbaC PE=3 SV=1 3 180 4.0E-34
sp|Q5U3F8|3HAO_DANRE 3-hydroxyanthranilate 3,4-dioxygenase OS=Danio rerio GN=haao PE=2 SV=1 9 166 2.0E-33
sp|Q5LSJ4|3HAO_RUEPO 3-hydroxyanthranilate 3,4-dioxygenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nbaC PE=3 SV=1 3 180 2.0E-33
sp|C1ERL1|3HAO_BACC3 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus cereus (strain 03BB102) GN=nbaC PE=3 SV=1 7 170 6.0E-33
sp|A0RD64|3HAO_BACAH 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus thuringiensis (strain Al Hakam) GN=nbaC PE=3 SV=1 7 170 7.0E-33
sp|Q739J0|3HAO_BACC1 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nbaC PE=3 SV=1 7 170 1.0E-32
sp|A6X798|3HAO_OCHA4 3-hydroxyanthranilate 3,4-dioxygenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nbaC PE=3 SV=1 3 180 1.0E-30
sp|Q1LCS4|3HAO_CUPMC 3-hydroxyanthranilate 3,4-dioxygenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nbaC PE=1 SV=1 15 173 1.0E-29
sp|Q19341|3HAO_CAEEL 3-hydroxyanthranilate 3,4-dioxygenase OS=Caenorhabditis elegans GN=haao-1 PE=3 SV=2 9 166 1.0E-28
sp|Q60W34|3HAO_CAEBR 3-hydroxyanthranilate 3,4-dioxygenase OS=Caenorhabditis briggsae GN=haao-1 PE=3 SV=2 9 166 2.0E-28
sp|B4EFS7|3HAO_BURCJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nbaC PE=3 SV=1 15 170 2.0E-28
sp|B2T2S5|3HAO_BURPP 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nbaC PE=3 SV=1 15 170 4.0E-27
sp|Q39LI1|3HAO_BURL3 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nbaC PE=3 SV=2 15 173 1.0E-26
sp|Q83V26|3HAO_PSEFL 3-hydroxyanthranilate 3,4-dioxygenase OS=Pseudomonas fluorescens GN=nbaC PE=1 SV=1 1 173 1.0E-25
sp|Q46PT7|3HAO_CUPPJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nbaC PE=3 SV=1 9 170 8.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0000334 3-hydroxyanthranilate 3,4-dioxygenase activity Yes
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0051213 dioxygenase activity No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4568
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7608
Ophiocordyceps australis map64 (Brazil) OphauB2|266
Ophiocordyceps camponoti-floridani Ophcf2|00165
Ophiocordyceps camponoti-rufipedis Ophun1|6732 (this protein)
Ophiocordyceps kimflemingae Ophio5|644
Ophiocordyceps subramaniannii Hirsu2|9576

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6732
MSISKQQQLEVDSRLDENAALLQPPINNYCVYNKDMTVMIVGGPNARTDYHINQTPEWFFQHRGAMLLKVVDQDM
FRDIVIPEGSMFLLPPGVPHNPVRFAHTVGIVLELPRPAGSVDGLRWYCAACARDDGSVVVVHEAAFHCTDLGSQ
IKEAVEDFAADHDKRTCPRCKRLADSAPPPGSIPDPNLVEPEAS*
Coding >Ophun1|6732
ATGAGCATCAGCAAGCAGCAGCAGCTTGAAGTCGATTCGAGGCTCGACGAAAACGCCGCCCTCCTCCAACCGCCC
ATCAACAACTACTGCGTCTACAACAAAGACATGACCGTCATGATCGTCGGCGGCCCCAACGCCCGTACAGACTAC
CACATCAACCAGACGCCAGAGTGGTTCTTCCAGCACCGCGGCGCCATGCTCCTCAAGGTCGTCGACCAAGACATG
TTCCGCGACATCGTCATCCCCGAGGGAAGCATGTTCCTGCTCCCGCCCGGCGTGCCTCATAATCCCGTTCGCTTC
GCTCATACCGTCGGCATTGTCCTCGAGTTGCCCCGTCCCGCCGGCTCGGTCGATGGTCTGCGCTGGTACTGCGCT
GCCTGTGCTCGCGACGATGGCTCCGTCGTCGTCGTTCATGAGGCTGCCTTTCACTGCACTGACCTCGGCTCCCAG
ATCAAGGAGGCCGTTGAGGACTTTGCTGCTGATCATGACAAGAGGACTTGTCCTCGCTGTAAGAGGCTGGCTGAT
AGCGCCCCTCCGCCTGGCTCCATCCCCGATCCGAATCTTGTCGAGCCCGAGGCGTCCTGA
Transcript >Ophun1|6732
ATGAGCATCAGCAAGCAGCAGCAGCTTGAAGTCGATTCGAGGCTCGACGAAAACGCCGCCCTCCTCCAACCGCCC
ATCAACAACTACTGCGTCTACAACAAAGACATGACCGTCATGATCGTCGGCGGCCCCAACGCCCGTACAGACTAC
CACATCAACCAGACGCCAGAGTGGTTCTTCCAGCACCGCGGCGCCATGCTCCTCAAGGTCGTCGACCAAGACATG
TTCCGCGACATCGTCATCCCCGAGGGAAGCATGTTCCTGCTCCCGCCCGGCGTGCCTCATAATCCCGTTCGCTTC
GCTCATACCGTCGGCATTGTCCTCGAGTTGCCCCGTCCCGCCGGCTCGGTCGATGGTCTGCGCTGGTACTGCGCT
GCCTGTGCTCGCGACGATGGCTCCGTCGTCGTCGTTCATGAGGCTGCCTTTCACTGCACTGACCTCGGCTCCCAG
ATCAAGGAGGCCGTTGAGGACTTTGCTGCTGATCATGACAAGAGGACTTGTCCTCGCTGTAAGAGGCTGGCTGAT
AGCGCCCCTCCGCCTGGCTCCATCCCCGATCCGAATCTTGTCGAGCCCGAGGCGTCCTGA
Gene >Ophun1|6732
ATGAGCATCAGCAAGCAGCAGCAGCTTGAAGTCGATTCGAGGTCAGCTGAGACATGATGGTCTGCCGTCGATGGG
CGCCGTGGCATCTGCATCTGCGCTGCCGGCATTCATTCACACGCCGCGCCCGCCTCGCTGCAGTTGTTCGGGTAC
GAATATGTAGCTGCTAATGCATGGTGCATCCCGTGCCGTGGCGTTGTGCCGTTAGCACTCGTCACCATATATACT
ATTCGCACGTGGATGACATGATATGACGCATCGCTCTTCAAATCATCAACCGCTAAGCGCAACCCTCCCCTCACA
CCAGATCTCGCATCCCACTCACCGGAATCCACCATCACCATCACCATCACCATCTCCCTTCCCTCAGAGTCCCTC
CCTACCTACAATGCTCCCTCCACCCCTAAACCTTCCCAAGTGGCAAGTCTCCAAATCTAAACCCCCCCCCCCAAA
CCTCAACTGACAAACAACCCCCCCAGGCTCGACGAAAACGCCGCCCTCCTCCAACCGCCCATCAACAACTACTGC
GTCTACAACAAAGACATGACCGTCATGGTACATACCATCCCATCCCATCCCATCTCTTCTTGGCTGAGACACGAA
AACCTCCTCTTCCCCCAAAACCTCGCTCCCAGATCGTCGGCGGCCCCAACGCCCGTACAGACTACCACATCAACC
AGACGCCAGAGTGGTTCTTCCAGCACCGCGGCGCCATGCTCCTCAAGGTCGTCGACCAAGACATGTTCCGCGACA
TCGTCATCCCCGAGGGAAGCATGTTCCTGCTCCCGCCCGGCGTGCCTCATAATCCCGTTCGCTTCGCTCATACCG
TCGGCATTGTCCTCGAGTTGCCCCGTCCCGCCGGCTCGGTCGATGGTCTGCGCTGGTACTGCGCTGCCTGTGCTC
GCGACGATGGCTCCGTCGTCGTCGTTCATGAGGCTGCCTTTCACTGCACTGACCTCGGCTCCCAGATCAAGGAGG
CCGTTGAGGACTTTGCTGCTGATCATGACAAGAGGACTTGTCCTCGCTGTAAGAGGCTGGCTGATAGCGCCCCTC
CGCCTGGCTCCATCCCCGATCCGAATCTTGTCGAGCCCGAGGCGTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail