Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|673
Gene name
LocationContig_121:21002..24698
Strand-
Gene length (bp)3696
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.2E-124 460 925
PF04108 ATG17_like Autophagy protein ATG17-like domain 9.1E-84 46 413
PF13520 AA_permease_2 Amino acid permease 2.8E-28 460 891

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 452 933 2.0E-126
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 431 933 3.0E-113
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 450 933 3.0E-111
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 452 933 4.0E-111
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 452 913 3.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 452 933 2.0E-126
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 431 933 3.0E-113
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 450 933 3.0E-111
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 452 933 4.0E-111
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 452 913 3.0E-109
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 450 933 2.0E-107
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 451 931 4.0E-105
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 453 933 5.0E-102
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 417 921 2.0E-98
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 450 933 1.0E-95
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 431 932 7.0E-93
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 425 931 2.0E-92
sp|Q872W1|ATG17_NEUCR Autophagy-related protein 17 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-9 PE=3 SV=1 31 421 4.0E-91
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 451 933 5.0E-91
sp|Q51Y68|ATG17_MAGO7 Autophagy-related protein 17 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG17 PE=3 SV=1 27 413 4.0E-90
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 452 888 1.0E-89
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 434 883 4.0E-89
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 439 931 5.0E-89
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 451 933 1.0E-88
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 442 927 6.0E-88
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 390 927 7.0E-88
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 432 933 9.0E-88
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 450 933 1.0E-87
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 453 883 3.0E-87
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 438 933 3.0E-87
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 450 921 6.0E-87
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 438 933 3.0E-85
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 451 933 1.0E-84
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 452 917 2.0E-81
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 423 933 1.0E-79
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 412 933 4.0E-77
sp|A7EM16|ATG17_SCLS1 Autophagy-related protein 17 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg17 PE=3 SV=1 34 414 1.0E-75
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 453 933 2.0E-75
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 406 928 3.0E-75
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 449 933 1.0E-73
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 450 931 3.0E-73
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 450 920 1.0E-72
sp|A6SG03|ATG17_BOTFB Autophagy-related protein 17 OS=Botryotinia fuckeliana (strain B05.10) GN=atg17 PE=3 SV=1 1 414 2.0E-72
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 451 933 1.0E-71
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 452 921 2.0E-70
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 452 884 5.0E-62
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 452 933 6.0E-62
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 452 931 7.0E-60
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 452 880 2.0E-59
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 443 884 9.0E-59
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 452 877 7.0E-57
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 450 877 2.0E-56
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 450 883 3.0E-53
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 450 883 3.0E-53
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 450 883 3.0E-53
sp|Q5AZC0|ATG17_EMENI Autophagy-related protein 17 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg17 PE=3 SV=2 13 409 1.0E-51
sp|Q2UFN7|ATG17_ASPOR Autophagy-related protein 17 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg17 PE=3 SV=1 14 413 2.0E-51
sp|A2QCV0|ATG17_ASPNC Autophagy-related protein 17 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg17 PE=3 SV=1 25 413 2.0E-50
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 453 869 3.0E-50
sp|Q0CY33|ATG17_ASPTN Autophagy-related protein 17 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg17 PE=3 SV=1 34 413 4.0E-50
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 453 869 4.0E-50
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 452 888 6.0E-50
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 450 887 8.0E-50
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 452 889 8.0E-50
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 452 889 2.0E-49
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 452 889 2.0E-49
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 452 889 3.0E-49
sp|Q4X0B0|ATG17_ASPFU Autophagy-related protein 17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg17 PE=3 SV=1 26 444 4.0E-49
sp|A1DHW5|ATG17_NEOFI Autophagy-related protein 17 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg17 PE=3 SV=1 26 413 2.0E-48
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 453 869 2.0E-47
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 453 869 2.0E-47
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 453 869 9.0E-47
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 452 889 2.0E-46
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 452 889 2.0E-46
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 452 889 2.0E-46
sp|A1C7E5|ATG17_ASPCL Autophagy-related protein 17 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg17 PE=3 SV=1 23 413 2.0E-46
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 452 888 4.0E-46
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 434 888 1.0E-45
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 434 888 1.0E-45
sp|A7KAM6|ATG17_PENRW Autophagy-related protein 17 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg17 PE=3 SV=1 34 413 2.0E-45
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 447 883 1.0E-43
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 452 887 3.0E-43
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 453 878 6.0E-42
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 451 846 1.0E-40
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 451 846 1.0E-40
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 452 925 4.0E-40
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 452 887 7.0E-39
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 452 887 7.0E-39
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 452 887 7.0E-39
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 452 872 5.0E-38
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 452 868 2.0E-37
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 452 883 2.0E-37
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 451 871 7.0E-36
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 452 604 4.0E-24
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 454 611 4.0E-17
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 453 782 8.0E-17
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 452 790 8.0E-09
sp|P76037|PUUP_ECOLI Putrescine importer PuuP OS=Escherichia coli (strain K12) GN=puuP PE=1 SV=2 487 716 1.0E-08
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 450 874 2.0E-07
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 449 784 2.0E-06
sp|O07576|YHDG_BACSU Uncharacterized amino acid permease YhdG OS=Bacillus subtilis (strain 168) GN=yhdG PE=2 SV=1 451 919 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 461 483 22
2 490 512 22
3 538 560 22
4 569 591 22
5 601 623 22
6 650 672 22
7 687 708 21
8 791 810 19
9 820 842 22
10 869 891 22
11 898 915 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|673
MAASPAASSRRSAASSAASLRRSMDKQPAVVSADALVSHLLVAKRSLSSMALVLRANEIATAARTAHEDEVMLAA
HMQFLAGSMADQVEILMRVRRALHATYDWGKRDFKKLVRAMDDVDGKLAMTMEMLRGTEVQDEMRPAGEERRNLL
DFVDETGVHAMREAMKQSIEELQGIQQSFDGDLLRFDTDMRDLKKVTMTDTQPAGEGDAKTSLELLLELEEHSAT
MAQLLASLTKHFDMCVTAMRTTEGAAAALARRRAAEVTQSQSGDGVSISGVMTEEAGGSGSGDLEPETAEERAEM
VRVVTQDAHEVDDVVREIQQRLAEMERSSATLDDQRRRTAEKHGRCRSAFWALSDVGGRLGDYVAAEADFRGRWE
AEKDVVSERLREMGSMRDFYEGYGSAYASLLLELERRRVQLGIIKSNVITDTQPIMATEKKPDLTSGTTTPSPPT
ALERRLSARHLQFIAIGGTIGTGLFLGIGPALAKSGPASLLLAFILIGAVSYSVMTALAEMAAYMPVTGAFTVYA
SRFIDPSVGFAMGWILLISWSLTLAVELVAAGLIIQYWDASLNVGIWIAVFLVVFTAANLLPIRWFGELEMWFSL
IKVIFIIGFVIFAACFNAGGVGSQGYLGFRYWRDPGAFAEYLVPGATGRFVGFWAVLVVAGFTYQGTELVAIGAG
ETRDPAKEIPSAIRWTYYGIVSLFLATVLFVGIDVPYNNPDLSSTNAQNAKDASASPLVIIARIGGVETLSHLIN
AVLLTAVLSAANSDIYSSSRIMIALADEGHAPAWVQRTNKYGTPYFAVLFCSAFGLFGFLKLSSESGVEVFAWLV
HITAIAGFVTWALINLCHLRFMSVLRCKGLSRESLPYKAPFQPWLSVFGLVLNVLILLTSGFTVFIEWKWKDFLA
AYVSIAIFFVFLVVHKVIYRTRPVKLDEVELSTS*
Coding >Ophun1|673
ATGGCCGCCTCGCCCGCTGCTTCGTCTCGCCGCAGCGCAGCGTCGTCGGCGGCTTCGCTTCGGCGATCGATGGAC
AAACAACCCGCCGTCGTGTCGGCCGATGCGCTGGTGAGCCACCTGCTGGTGGCCAAGCGGTCGCTGTCGTCGATG
GCGTTGGTGCTGCGGGCAAACGAGATCGCGACGGCTGCTCGGACGGCGCATGAGGATGAGGTGATGCTGGCGGCG
CATATGCAGTTCCTGGCCGGATCCATGGCCGATCAGGTGGAGATTCTCATGAGGGTGCGTCGGGCGCTGCACGCA
ACGTACGACTGGGGGAAGCGGGATTTCAAGAAGCTCGTTCGCGCCATGGACGATGTCGACGGGAAGCTGGCCATG
ACGATGGAGATGCTGCGCGGCACTGAGGTGCAGGATGAGATGCGGCCGGCTGGCGAGGAGAGACGGAATCTGCTG
GATTTCGTGGATGAGACGGGGGTTCATGCCATGAGGGAGGCCATGAAGCAGAGTATAGAGGAGCTGCAGGGGATA
CAGCAGTCTTTCGATGGAGATCTCCTCCGGTTCGACACAGATATGCGCGACCTGAAGAAGGTCACCATGACGGAC
ACGCAGCCAGCAGGCGAGGGCGACGCCAAGACGTCACTGGAGCTGCTTCTCGAGCTGGAAGAGCATTCGGCGACC
ATGGCGCAGCTGTTGGCGTCGCTGACCAAACACTTTGACATGTGCGTGACGGCGATGCGGACGACGGAGGGAGCC
GCAGCGGCGCTGGCGAGACGACGAGCGGCTGAAGTGACGCAGTCTCAGAGCGGCGACGGCGTGTCCATCTCGGGC
GTCATGACGGAGGAGGCGGGCGGCAGCGGCAGCGGAGACTTGGAACCGGAGACGGCAGAGGAGCGAGCAGAGATG
GTGCGAGTGGTGACGCAAGACGCGCACGAAGTCGACGACGTGGTCCGCGAGATCCAGCAACGCCTAGCCGAAATG
GAGCGCTCCAGCGCAACCCTCGACGACCAGAGAAGACGAACGGCCGAGAAACACGGCCGCTGCCGGTCAGCCTTC
TGGGCGCTCTCGGACGTGGGCGGCCGGTTGGGCGACTACGTGGCGGCCGAAGCCGACTTCCGCGGGCGGTGGGAG
GCGGAGAAGGACGTGGTATCGGAGCGGCTGCGGGAGATGGGCTCGATGCGCGACTTTTACGAGGGCTACGGCAGT
GCGTATGCCAGTCTGCTGCTGGAGCTGGAGAGGCGGAGGGTCCAGCTCGGCATCATCAAATCCAACGTTATCACC
GACACCCAACCCATCATGGCAACCGAGAAGAAGCCGGATCTCACATCCGGCACCACCACGCCCTCCCCTCCCACG
GCGCTGGAACGAAGACTCTCAGCCCGCCATCTGCAGTTCATAGCCATAGGCGGCACCATCGGAACCGGCCTGTTC
CTGGGCATTGGTCCCGCGCTGGCCAAATCCGGTCCTGCGTCGCTGCTGCTCGCCTTTATCCTCATCGGCGCTGTG
TCCTATAGCGTCATGACGGCTCTGGCCGAGATGGCGGCTTACATGCCCGTCACCGGCGCCTTCACCGTCTACGCC
TCGCGCTTCATCGACCCGTCGGTTGGGTTTGCCATGGGATGGATCTTGTTGATTTCTTGGTCGCTTACTCTTGCT
GTTGAGCTTGTAGCCGCGGGACTCATCATCCAATACTGGGACGCAAGTCTCAACGTCGGAATCTGGATCGCCGTC
TTCCTCGTCGTCTTCACCGCCGCCAACCTCCTCCCCATCCGCTGGTTCGGCGAGTTGGAGATGTGGTTCTCCCTC
ATCAAAGTCATCTTCATCATCGGCTTCGTCATCTTCGCCGCCTGCTTCAACGCCGGCGGTGTAGGGTCGCAGGGC
TATCTCGGCTTCCGCTACTGGAGGGATCCCGGCGCGTTTGCAGAGTATCTCGTTCCCGGCGCCACGGGACGCTTC
GTCGGGTTTTGGGCTGTCCTGGTGGTTGCGGGATTTACCTATCAGGGCACTGAGTTGGTTGCCATTGGGGCGGGA
GAGACGCGTGATCCGGCAAAGGAGATTCCGTCTGCTATTCGATGGACTTACTACGGCATCGTCAGCCTCTTCCTG
GCAACCGTCCTCTTCGTCGGCATCGACGTCCCTTACAACAACCCCGACCTATCAAGCACCAATGCCCAAAACGCG
AAAGACGCTTCAGCCTCCCCCCTCGTCATCATAGCCCGCATCGGCGGCGTAGAAACCCTCTCGCATCTAATAAAC
GCCGTCCTTCTAACCGCCGTCCTCAGCGCCGCAAACTCGGACATCTACTCGAGCAGCAGGATAATGATCGCCCTC
GCAGACGAAGGCCACGCCCCAGCCTGGGTCCAACGCACAAACAAGTACGGAACTCCCTACTTCGCCGTCCTCTTC
TGCTCGGCCTTCGGCCTCTTCGGCTTCCTGAAGCTCTCGTCGGAATCGGGCGTCGAGGTGTTCGCCTGGCTGGTG
CACATCACCGCCATTGCGGGCTTCGTCACCTGGGCGCTCATCAACCTGTGTCACCTGCGCTTCATGTCGGTGCTG
CGATGCAAGGGCCTGTCGAGGGAGAGTCTGCCGTACAAGGCGCCCTTTCAGCCTTGGCTTTCCGTCTTTGGCCTT
GTTTTGAATGTGCTGATTCTGCTGACGAGTGGGTTTACCGTCTTTATTGAGTGGAAGTGGAAGGATTTCCTGGCT
GCCTATGTTAGCATTGCCATCTTTTTCGTGTTTTTGGTGGTGCACAAGGTTATTTACAGGACGAGGCCGGTGAAG
CTTGACGAGGTCGAGTTGTCGACGTCTTAG
Transcript >Ophun1|673
ATGGCCGCCTCGCCCGCTGCTTCGTCTCGCCGCAGCGCAGCGTCGTCGGCGGCTTCGCTTCGGCGATCGATGGAC
AAACAACCCGCCGTCGTGTCGGCCGATGCGCTGGTGAGCCACCTGCTGGTGGCCAAGCGGTCGCTGTCGTCGATG
GCGTTGGTGCTGCGGGCAAACGAGATCGCGACGGCTGCTCGGACGGCGCATGAGGATGAGGTGATGCTGGCGGCG
CATATGCAGTTCCTGGCCGGATCCATGGCCGATCAGGTGGAGATTCTCATGAGGGTGCGTCGGGCGCTGCACGCA
ACGTACGACTGGGGGAAGCGGGATTTCAAGAAGCTCGTTCGCGCCATGGACGATGTCGACGGGAAGCTGGCCATG
ACGATGGAGATGCTGCGCGGCACTGAGGTGCAGGATGAGATGCGGCCGGCTGGCGAGGAGAGACGGAATCTGCTG
GATTTCGTGGATGAGACGGGGGTTCATGCCATGAGGGAGGCCATGAAGCAGAGTATAGAGGAGCTGCAGGGGATA
CAGCAGTCTTTCGATGGAGATCTCCTCCGGTTCGACACAGATATGCGCGACCTGAAGAAGGTCACCATGACGGAC
ACGCAGCCAGCAGGCGAGGGCGACGCCAAGACGTCACTGGAGCTGCTTCTCGAGCTGGAAGAGCATTCGGCGACC
ATGGCGCAGCTGTTGGCGTCGCTGACCAAACACTTTGACATGTGCGTGACGGCGATGCGGACGACGGAGGGAGCC
GCAGCGGCGCTGGCGAGACGACGAGCGGCTGAAGTGACGCAGTCTCAGAGCGGCGACGGCGTGTCCATCTCGGGC
GTCATGACGGAGGAGGCGGGCGGCAGCGGCAGCGGAGACTTGGAACCGGAGACGGCAGAGGAGCGAGCAGAGATG
GTGCGAGTGGTGACGCAAGACGCGCACGAAGTCGACGACGTGGTCCGCGAGATCCAGCAACGCCTAGCCGAAATG
GAGCGCTCCAGCGCAACCCTCGACGACCAGAGAAGACGAACGGCCGAGAAACACGGCCGCTGCCGGTCAGCCTTC
TGGGCGCTCTCGGACGTGGGCGGCCGGTTGGGCGACTACGTGGCGGCCGAAGCCGACTTCCGCGGGCGGTGGGAG
GCGGAGAAGGACGTGGTATCGGAGCGGCTGCGGGAGATGGGCTCGATGCGCGACTTTTACGAGGGCTACGGCAGT
GCGTATGCCAGTCTGCTGCTGGAGCTGGAGAGGCGGAGGGTCCAGCTCGGCATCATCAAATCCAACGTTATCACC
GACACCCAACCCATCATGGCAACCGAGAAGAAGCCGGATCTCACATCCGGCACCACCACGCCCTCCCCTCCCACG
GCGCTGGAACGAAGACTCTCAGCCCGCCATCTGCAGTTCATAGCCATAGGCGGCACCATCGGAACCGGCCTGTTC
CTGGGCATTGGTCCCGCGCTGGCCAAATCCGGTCCTGCGTCGCTGCTGCTCGCCTTTATCCTCATCGGCGCTGTG
TCCTATAGCGTCATGACGGCTCTGGCCGAGATGGCGGCTTACATGCCCGTCACCGGCGCCTTCACCGTCTACGCC
TCGCGCTTCATCGACCCGTCGGTTGGGTTTGCCATGGGATGGATCTTGTTGATTTCTTGGTCGCTTACTCTTGCT
GTTGAGCTTGTAGCCGCGGGACTCATCATCCAATACTGGGACGCAAGTCTCAACGTCGGAATCTGGATCGCCGTC
TTCCTCGTCGTCTTCACCGCCGCCAACCTCCTCCCCATCCGCTGGTTCGGCGAGTTGGAGATGTGGTTCTCCCTC
ATCAAAGTCATCTTCATCATCGGCTTCGTCATCTTCGCCGCCTGCTTCAACGCCGGCGGTGTAGGGTCGCAGGGC
TATCTCGGCTTCCGCTACTGGAGGGATCCCGGCGCGTTTGCAGAGTATCTCGTTCCCGGCGCCACGGGACGCTTC
GTCGGGTTTTGGGCTGTCCTGGTGGTTGCGGGATTTACCTATCAGGGCACTGAGTTGGTTGCCATTGGGGCGGGA
GAGACGCGTGATCCGGCAAAGGAGATTCCGTCTGCTATTCGATGGACTTACTACGGCATCGTCAGCCTCTTCCTG
GCAACCGTCCTCTTCGTCGGCATCGACGTCCCTTACAACAACCCCGACCTATCAAGCACCAATGCCCAAAACGCG
AAAGACGCTTCAGCCTCCCCCCTCGTCATCATAGCCCGCATCGGCGGCGTAGAAACCCTCTCGCATCTAATAAAC
GCCGTCCTTCTAACCGCCGTCCTCAGCGCCGCAAACTCGGACATCTACTCGAGCAGCAGGATAATGATCGCCCTC
GCAGACGAAGGCCACGCCCCAGCCTGGGTCCAACGCACAAACAAGTACGGAACTCCCTACTTCGCCGTCCTCTTC
TGCTCGGCCTTCGGCCTCTTCGGCTTCCTGAAGCTCTCGTCGGAATCGGGCGTCGAGGTGTTCGCCTGGCTGGTG
CACATCACCGCCATTGCGGGCTTCGTCACCTGGGCGCTCATCAACCTGTGTCACCTGCGCTTCATGTCGGTGCTG
CGATGCAAGGGCCTGTCGAGGGAGAGTCTGCCGTACAAGGCGCCCTTTCAGCCTTGGCTTTCCGTCTTTGGCCTT
GTTTTGAATGTGCTGATTCTGCTGACGAGTGGGTTTACCGTCTTTATTGAGTGGAAGTGGAAGGATTTCCTGGCT
GCCTATGTTAGCATTGCCATCTTTTTCGTGTTTTTGGTGGTGCACAAGGTTATTTACAGGACGAGGCCGGTGAAG
CTTGACGAGGTCGAGTTGTCGACGTCTTAG
Gene >Ophun1|673
ATGGCCGCCTCGCCCGCTGCTTCGTCTCGCCGCAGCGCAGCGTCGTCGGCGGCTTCGCTTCGGCGATCGATGGAC
AAACAACCCGCCGTCGTGTCGGCCGATGCGCTGGTGAGCCACCTGCTGGTGGCCAAGCGGTCGCTGTCGTCGATG
GCGTTGGTGCTGCGGGCAAACGAGATCGCGACGGCTGCTCGGACGGCGCATGAGGATGAGGTGATGCTGGCGGCG
CATATGCAGTTCCTGGCCGGATCCATGGCCGATCAGGTGGAGATTCTCATGAGGGTGCGTCGGGCGCTGCACGCA
ACGTACGACTGGGGGAAGCGGGATTTCAAGAAGCTCGTTCGCGCCATGGACGATGTCGACGGGAAGCTGGCCATG
ACGATGGAGATGCTGCGCGGCACTGAGGTGCAGGATGAGATGCGGCCGGCTGGCGAGGAGAGACGGAATCTGCTG
GATTTCGTGGATGAGACGGGGGTTCATGCCATGAGGGAGGCCATGAAGCAGAGTATAGAGGAGCTGCAGGTGAGA
TTTGCCTCCCTTGTTCTCCTGATCATCGTGTCGCAGTCGCTGACGATGAGAGGGGACAGGGGATACAGCAGTCTT
TCGATGGAGATCTCCTCCGGTTCGACACAGATATGCGCGACCTGAAGAAGGTCACCATGACGGACACGCAGCCAG
CAGGCGAGGGCGACGCCAAGACGTCACTGGAGCTGCTTCTCGAGCTGGAAGAGCATTCGGCGACCATGGCGCAGC
TGTTGGCGTCGCTGACCAAACACTTTGACATGTGCGTGACGGCGATGCGGACGACGGAGGGAGCCGCAGCGGCGC
TGGCGAGACGACGAGCGGCTGAAGTGACGCAGTCTCAGAGCGGCGACGGCGTGTCCATCTCGGGCGTCATGACGG
AGGAGGCGGGCGGCAGCGGCAGCGGAGACTTGGAACCGGAGACGGCAGAGGAGCGAGCAGAGATGGTGCGAGTGG
TGACGCAAGACGCGCACGAAGTCGACGACGTGGTCCGCGAGATCCAGCAACGCCTAGCCGAAATGGAGCGCTCCA
GCGCAACCCTCGACGACCAGAGAAGACGAACGGCCGAGAAACACGGCCGCTGCCGGTCAGCCTTCTGGGCGCTCT
CGGACGTGGGCGGCCGGTTGGGCGACTACGTGGCGGCCGAAGCCGACTTCCGCGGGCGGTGGGAGGCGGAGAAGG
ACGTGGTATCGGAGCGGCTGCGGGAGATGGGCTCGATGCGCGACTTTTACGAGGGCTACGGCAGTGCGTATGCCA
GTCTGCTGCTGGAGCTGGAGAGGCGGAGGTCGGTGGAGAGGCAGGTTGAGGCTGTGTGGCGGAAGGCGAGCGAGG
GGATTGAGAGGCTGCTTGAGGCGGATTGTGCGGCGAGGGATGCTTTTCGGGCCGAGGTTGGGGATTTCTTGCCGG
CGGAGTGGGAGGGGGTTGGGCCGGCGGTTAGGAGGTGGAGGGTTGTGCCTGAGGAGGGGTGAGGGAGTTGGTGAT
GATGGTTTGGGAGGGTTGTTTGTTGGGTAGTTGTTGGTGTTGTTGTTGGTGTTGTTGCTGCTGCTGTTGTTGATG
TTGATTGGTTGGTTGGTTGGTTGGTTGTCTGTAAGAGGAGTTGTTCGTCTTCGGCTCTCGCAACCAGACAGACAC
CCCGGACACCAGCAGATGGCCGGTTCTATCGACGGATGCTGTCACCCGCTCCGGCGGTAACGCCAACGGCGGCAG
AAACAGTCGTCTTCCACGTGGAGCATCGTGACGAGGCCAACGCGTCTCCACCAGACCGATCATCATCTCAAAGCC
ATCATGCGCCTCTCCCCCTTTCCATCATCATCCGTGCCTCTTCATATCTTCATATCCCTCTCTCCCCATCTCATC
TCCATAGAAAACGACAACGACAATGACTCCAACCAGGGTCCAGCTCGGCATCATCAAATCCAACGTTATCACCGA
CACCCGTCTCCGCATCGCCAAGCCCGCGCAGAGTTTTCCACCTCCCGTATCGGAGCCAAGATAGCGGGTCAAGAT
GACGGGCATGACACACGAAAGAAAATGGGGAAAAAAAATAATAACAACAACAACAACTGCTCAATTCTCTTCTCC
CTTTCTGCTTCCCCCCCTTCAACCACCACCACCACAACCACCACCTCCACAACACCCGCTAGCACGAAGCAAGAA
CCCATCATGGCAACCGAGAAGAAGCCGGATCTCACATCCGGCACCACCACGCCCTCCCCTCCCACGGCGCTGGAA
CGAAGACTCTCAGCCCGCCATCTGCAGTTCATAGCCATAGGCGGCACCATCGGAACCGGCCTGTTCCTGGGCATT
GGTCCCGCGCTGGCCAAATCCGGTCCTGCGTCGCTGCTGCTCGCCTTTATCCTCATCGGCGCTGTGTCCTATAGC
GTCATGACGGCTCTGGCCGAGATGGCGGCTTACATGCCCGTCACCGGCGCCTTCACCGTCTACGCCTCGCGCTTC
ATCGACCCGTCGGTTGGGTTTGCCATGGGATGGATCTTGTTGATTTCTTGGTCGCTTACTCTTGCTGTTGAGCTT
GTAGCCGCGGGACTCATCATCCAATACTGGGACGCAAGTCTCAACGTCGGAATCTGGATCGCCGTCTTCCTCGTC
GTCTTCACCGCCGCCAACCTCCTCCCCATCCGCTGGTTCGGCGAGTTGGAGATGTGGTTCTCCCTCATCAAAGTC
ATCTTCATCATCGGCTTCGTCATCTTCGCCGCCTGCTTCAACGCCGGCGGTGTAGGGTCGCAGGGCTATCTCGGC
TTCCGCTACTGGAGGGATCCCGGCGCGTTTGCAGAGTATCTCGTTCCCGGCGCCACGGGACGCTTCGTCGGGTTT
TGGGCTGTCCTGGTGGTTGCGGGATTTACCTATCAGGGCACTGAGTTGGTTGCCATTGGGGCGGGAGAGACGCGT
GATCCGGCAAAGGAGATTCCGTCTGCTATTCGATGGACTTACTACGGCATCGTCAGCCTCTTCCTGGCAACCGTC
CTCTTCGTCGGCATCGACGTCCCTTACAACAACCCCGACCTATCAAGCACCAATGCCCAAAACGCGAAAGACGCT
TCAGCCTCCCCCCTCGTCATCATAGCCCGCATCGGCGGCGTAGAAACCCTCTCGCATCTAATAAACGCCGTCCTT
CTAACCGCCGTCCTCAGCGCCGCAAACTCGGACATCTACTCGAGCAGCAGGATAATGATCGCCCTCGCAGACGAA
GGCCACGCCCCAGCCTGGGTCCAACGCACAAACAAGTACGGAACTCCCTACTTCGCCGTCCTCTTCTGCTCGGCC
TTCGGCCTCTTCGGCTTCCTGAAGCTCTCGTCGGAATCGGGCGTCGAGGTGTTCGCCTGGCTGGTGCACATCACC
GCCATTGCGGGCTTCGTCACCTGGGCGCTCATCAACCTGTGTCACCTGCGCTTCATGTCGGTGCTGCGATGCAAG
GGCCTGTCGAGGGAGAGTCTGCCGTACAAGGCGCCCTTTCAGCCTTGGCTTTCCGTCTTTGGCCTTGTTTTGAAT
GTGCTGATTCTGCTGACGAGTGGGTTTACCGTCTTTATTGAGTGGAAGTGGAAGGATTTCCTGGCTGCCTATGTT
AGCATTGCCATCTTTTTCGTGTTTTTGGTGGTGCACAAGGTTATTTACAGGACGAGGCCGGTGAAGCTTGACGAG
GTCGAGTTGTCGACGTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail