Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6726
Gene name
LocationContig_761:4605..6036
Strand+
Gene length (bp)1431
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.1E-31 11 395
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.3E-06 14 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 13 413 3.0E-37
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 13 410 7.0E-32
sp|P40859|MSOX_BACB0 Monomeric sarcosine oxidase OS=Bacillus sp. (strain B-0618) GN=soxA PE=1 SV=2 8 395 2.0E-11
sp|Q29RU9|SOX_BOVIN Peroxisomal sarcosine oxidase OS=Bos taurus GN=PIPOX PE=2 SV=2 1 165 9.0E-08
sp|Q9D826|SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus GN=Pipox PE=1 SV=1 13 163 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 13 413 3.0E-37
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 13 410 7.0E-32
sp|P40859|MSOX_BACB0 Monomeric sarcosine oxidase OS=Bacillus sp. (strain B-0618) GN=soxA PE=1 SV=2 8 395 2.0E-11
sp|Q29RU9|SOX_BOVIN Peroxisomal sarcosine oxidase OS=Bos taurus GN=PIPOX PE=2 SV=2 1 165 9.0E-08
sp|Q9D826|SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus GN=Pipox PE=1 SV=1 13 163 2.0E-07
sp|P40873|MSOX_ARTST Monomeric sarcosine oxidase OS=Arthrobacter sp. (strain TE1826) GN=soxA PE=1 SV=2 3 221 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6726
MSSQRTDTDIHYLIIGAGNFGAATALTLAKRGGARVTLVDSAAYPNRRAASYDVNKIVRDDYPDKLYMRMLIKAM
PKWREDELYSSYYHEVGMLRVDESDFGVESIAAYRDMGIDNDSEFLPVDEVRRRWNGAFSTSNFGDVETILFNPT
VGFAEADKALEAVIDEAILRRRVNFVQATVSRLDFGPSGQCIGLTLENGDSLRADKILLAAGARTPALLAQSAPA
NKDLHVGSRLMATGAISFHAQLTGDQRAKFAPIPVVKNCLPGVKGEGMSILDDGTIKFNCDMCFTNYVTFPPTGE
RMSVAPDETVYNEWTGPRFVSFFQERARKTMNGLYGKEVEEITIQKYRMCWDASTPTHDFLITPHPHSQGLYLAT
GGSFHGWKFLPVIGDYVADMMQGCLDDDYAARWAWDKKGGDGHSANPTYAVVGDLQDWI*
Coding >Ophun1|6726
ATGTCGTCTCAACGCACCGACACAGACATTCACTACCTCATCATCGGAGCGGGCAACTTCGGCGCCGCCACCGCC
CTGACGCTAGCCAAGCGTGGTGGCGCTCGAGTTACACTCGTCGACTCGGCTGCGTATCCGAACCGCAGAGCCGCG
TCTTACGATGTCAACAAGATCGTTCGCGATGACTATCCGGACAAGCTCTACATGCGCATGCTCATCAAGGCCATG
CCCAAGTGGCGCGAGGATGAGCTCTACAGCTCCTACTACCACGAGGTCGGCATGCTTCGCGTCGATGAGTCCGAC
TTTGGCGTGGAGAGCATAGCCGCGTATCGGGACATGGGCATCGACAACGACTCCGAGTTTCTACCCGTCGACGAG
GTCAGGAGACGCTGGAACGGTGCCTTCAGCACATCCAACTTTGGCGACGTCGAGACCATCCTCTTCAACCCGACT
GTTGGCTTCGCCGAGGCCGACAAGGCTCTCGAGGCCGTCATTGACGAGGCCATCTTGAGGAGACGCGTCAACTTC
GTTCAGGCCACCGTCAGCCGCCTCGACTTTGGGCCCTCGGGCCAGTGCATCGGTCTCACCCTGGAAAACGGTGAT
AGCTTGCGAGCCGACAAGATCCTGCTGGCCGCCGGCGCCCGGACCCCGGCGCTGCTGGCTCAGAGCGCCCCTGCC
AACAAGGACCTGCATGTTGGTTCTCGACTGATGGCGACGGGGGCTATCAGCTTCCACGCCCAGCTGACCGGGGAC
CAAAGGGCCAAGTTCGCGCCCATCCCCGTCGTCAAGAACTGCTTGCCGGGGGTCAAAGGAGAGGGAATGTCCATC
CTTGACGACGGCACCATCAAGTTCAACTGTGACATGTGCTTCACAAACTACGTCACCTTCCCGCCTACGGGCGAG
CGCATGTCAGTGGCCCCGGACGAGACGGTTTACAACGAGTGGACCGGGCCGCGCTTCGTCAGTTTCTTCCAGGAG
CGAGCGCGCAAGACGATGAACGGCCTCTACGGCAAGGAGGTGGAAGAGATTACCATTCAAAAGTATCGCATGTGC
TGGGATGCATCGACACCGACACACGACTTCCTCATCACGCCGCATCCGCACAGCCAAGGCCTCTATCTTGCCACC
GGCGGCTCATTCCACGGATGGAAGTTCCTGCCAGTCATCGGCGACTACGTTGCAGACATGATGCAAGGTTGCCTG
GATGATGATTATGCTGCTCGTTGGGCATGGGACAAGAAGGGCGGGGACGGCCACTCTGCCAATCCGACGTACGCA
GTGGTAGGAGACTTGCAGGACTGGATCTGA
Transcript >Ophun1|6726
ATGTCGTCTCAACGCACCGACACAGACATTCACTACCTCATCATCGGAGCGGGCAACTTCGGCGCCGCCACCGCC
CTGACGCTAGCCAAGCGTGGTGGCGCTCGAGTTACACTCGTCGACTCGGCTGCGTATCCGAACCGCAGAGCCGCG
TCTTACGATGTCAACAAGATCGTTCGCGATGACTATCCGGACAAGCTCTACATGCGCATGCTCATCAAGGCCATG
CCCAAGTGGCGCGAGGATGAGCTCTACAGCTCCTACTACCACGAGGTCGGCATGCTTCGCGTCGATGAGTCCGAC
TTTGGCGTGGAGAGCATAGCCGCGTATCGGGACATGGGCATCGACAACGACTCCGAGTTTCTACCCGTCGACGAG
GTCAGGAGACGCTGGAACGGTGCCTTCAGCACATCCAACTTTGGCGACGTCGAGACCATCCTCTTCAACCCGACT
GTTGGCTTCGCCGAGGCCGACAAGGCTCTCGAGGCCGTCATTGACGAGGCCATCTTGAGGAGACGCGTCAACTTC
GTTCAGGCCACCGTCAGCCGCCTCGACTTTGGGCCCTCGGGCCAGTGCATCGGTCTCACCCTGGAAAACGGTGAT
AGCTTGCGAGCCGACAAGATCCTGCTGGCCGCCGGCGCCCGGACCCCGGCGCTGCTGGCTCAGAGCGCCCCTGCC
AACAAGGACCTGCATGTTGGTTCTCGACTGATGGCGACGGGGGCTATCAGCTTCCACGCCCAGCTGACCGGGGAC
CAAAGGGCCAAGTTCGCGCCCATCCCCGTCGTCAAGAACTGCTTGCCGGGGGTCAAAGGAGAGGGAATGTCCATC
CTTGACGACGGCACCATCAAGTTCAACTGTGACATGTGCTTCACAAACTACGTCACCTTCCCGCCTACGGGCGAG
CGCATGTCAGTGGCCCCGGACGAGACGGTTTACAACGAGTGGACCGGGCCGCGCTTCGTCAGTTTCTTCCAGGAG
CGAGCGCGCAAGACGATGAACGGCCTCTACGGCAAGGAGGTGGAAGAGATTACCATTCAAAAGTATCGCATGTGC
TGGGATGCATCGACACCGACACACGACTTCCTCATCACGCCGCATCCGCACAGCCAAGGCCTCTATCTTGCCACC
GGCGGCTCATTCCACGGATGGAAGTTCCTGCCAGTCATCGGCGACTACGTTGCAGACATGATGCAAGGTTGCCTG
GATGATGATTATGCTGCTCGTTGGGCATGGGACAAGAAGGGCGGGGACGGCCACTCTGCCAATCCGACGTACGCA
GTGGTAGGAGACTTGCAGGACTGGATCTGA
Gene >Ophun1|6726
ATGTCGTCTCAACGCACCGACACAGACATTCACTACCTCATCATCGGAGCGGGCAACTTCGGCGCCGCCACCGCC
CTGACGCTAGCCAAGCGTGGTGGCGCTCGAGTTACACTCGTCGACTCGGCTGCGTATCCGAACCGCAGAGCCGCG
TCTTACGATGTCAACAAGATCGTTCGCGATGACTATCCGGACAAGCTCTACATGCGCATGCTCATCAAGGCCATG
CCCAAGTGGCGCGAGGATGAGCTCTACAGCTCCTACTACCACGAGGTCGGCATGCTTCGCGTCGATGAGTCCGAC
TTTGGCGTGGAGAGCATAGCCGCGTATCGGGACATGGGCATCGACAACGACTCCGAGTTTCTACCCGTCGACGAG
GTCAGGAGACGCTGGAACGGTGCCTTCAGCACATCCAACTTTGGCGACGTCGAGACCATCCTCTTCAACCCGACT
GTTGGCTTCGCCGAGGCCGACAAGGCTCTCGAGGCCGTCATTGACGAGGCCATCTTGAGGAGACGCGTCAACTTC
GTTCAGGCCACCGTCAGCCGCCTCGACTTTGGGCCCTCGGGCCAGTGCATCGGTCTCACCCTGGAAAACGGTGAT
AGCTTGCGAGCCGACAAGATCCTGCTGGCCGCCGGCGCCCGGACCCCGGCGCTGCTGGCTCAGAGCGCCCCTGCC
AACAAGGACCTGCATGTTGGTTCTCGACTGATGGCGACGGGGGCTATCAGCTTCCACGCCCAGCTGACCGGGGAC
CAAAGGGCCAAGTTCGCGCCCATCCCCGTCGTCAAGAACTGCTTGCCGGGGGTCAAAGGTATGTATGCCCTTGTC
ATCCGAGCCGGCTCATTGGCGAACAAGGCGCTGACCGGTCGGCTCGATGCAGGAGAGGGAATGTCCATCCTTGAC
GACGGCACCATCAAGTTCAACTGTGACATGTGCTTCACAAACTACGTCACCTTCCCGCCTACGGGCGAGCGCATG
TCAGTGGCCCCGGACGAGACGGTTTACAACGAGTGGACCGGGCCGCGCTTCGTCAGTTTCTTCCAGGAGCGAGCG
CGCAAGACGATGAACGGCCTCTACGGCAAGGAGGTGGAAGAGATTACCATTCAAAAGTATCGCATGTGCTGGTAA
GTGACGCGCTGCCGATGCCGAGTTACCCTCGATCTGACGGCCCGCCTCGGCAGGGATGCATCGACACCGACACAC
GACTTCCTCATCACGCCGCATCCGCACAGCCAAGGCCTCTATCTTGCCACCGGCGGCTCATTCCACGGATGGAAG
TTCCTGCCAGTCATCGGCGACTACGTTGCAGACATGATGCAAGGTTGCCTGGATGATGATTATGCTGCTCGTTGG
GCATGGGACAAGAAGGGCGGGGACGGCCACTCTGCCAATCCGACGTACGCAGTGGTAGGAGACTTGCAGGACTGG
ATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail