Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6723
Gene name
LocationContig_76:40991..43609
Strand-
Gene length (bp)2618
Transcript length (bp)2520
Coding sequence length (bp)2520
Protein length (aa) 840

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06602 Myotub-related Myotubularin-like phosphatase domain 5.8E-151 118 579

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 643 7.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 646 1.0E-123
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 80 637 8.0E-90
sp|Q6AXQ4|MTM1_RAT Myotubularin OS=Rattus norvegicus GN=Mtm1 PE=2 SV=2 80 683 2.0E-89
sp|Q5R9S3|MTM1_PONAB Myotubularin OS=Pongo abelii GN=MTM1 PE=2 SV=1 80 637 3.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 643 7.0E-152
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 646 1.0E-123
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 80 637 8.0E-90
sp|Q6AXQ4|MTM1_RAT Myotubularin OS=Rattus norvegicus GN=Mtm1 PE=2 SV=2 80 683 2.0E-89
sp|Q5R9S3|MTM1_PONAB Myotubularin OS=Pongo abelii GN=MTM1 PE=2 SV=1 80 637 3.0E-89
sp|Q5EB32|MTM1_XENTR Myotubularin OS=Xenopus tropicalis GN=mtm1 PE=2 SV=1 80 637 3.0E-89
sp|Q52KU6|MTM1_XENLA Myotubularin OS=Xenopus laevis GN=mtm1 PE=2 SV=1 80 637 6.0E-89
sp|A6QLT4|MTM1_BOVIN Myotubularin OS=Bos taurus GN=MTM1 PE=2 SV=2 80 637 5.0E-88
sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 21 642 2.0E-81
sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 80 637 7.0E-81
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 21 642 1.0E-80
sp|Q9Z2C9|MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus GN=Mtmr7 PE=1 SV=2 21 637 4.0E-78
sp|Q8VE11|MTMR6_MOUSE Myotubularin-related protein 6 OS=Mus musculus GN=Mtmr6 PE=1 SV=1 1 643 3.0E-76
sp|Q5F452|MTMR8_CHICK Myotubularin-related protein 8 OS=Gallus gallus GN=MTMR8 PE=2 SV=1 17 643 3.0E-73
sp|Q9Y217|MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens GN=MTMR6 PE=1 SV=3 1 606 2.0E-70
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 118 453 8.0E-70
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 118 453 1.0E-69
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 118 453 2.0E-69
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 118 453 5.0E-69
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 78 453 2.0E-68
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 20 454 2.0E-66
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 17 454 5.0E-61
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 78 453 6.0E-61
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 78 453 7.0E-61
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 80 453 2.0E-59
sp|F4J3T8|MYTM1_ARATH Phosphatidylinositol-3-phosphatase myotubularin-1 OS=Arabidopsis thaliana GN=MTM1 PE=1 SV=1 153 452 2.0E-54
sp|F4JWB3|MYTM2_ARATH Phosphatidylinositol-3-phosphatase myotubularin-2 OS=Arabidopsis thaliana GN=MTM2 PE=1 SV=1 150 452 2.0E-54
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 78 453 7.0E-48
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 78 453 7.0E-48
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 141 453 7.0E-47
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 78 453 2.0E-46
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 78 458 4.0E-46
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 78 458 7.0E-46
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 143 445 9.0E-36
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 77 453 3.0E-33
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 158 453 6.0E-24
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 158 453 6.0E-23
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 524 639 2.0E-22
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 148 451 6.0E-22
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 338 453 9.0E-20
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 527 606 3.0E-19
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 527 606 3.0E-19
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 527 642 3.0E-19
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 527 642 6.0E-19
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 527 606 8.0E-19
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 77 242 2.0E-18
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 527 642 3.0E-18
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 527 642 3.0E-18
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 78 238 3.0E-18
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 77 242 4.0E-18
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 527 642 8.0E-18
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 523 643 6.0E-17
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 303 453 1.0E-16
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 303 453 8.0E-16
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 528 606 1.0E-15
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 528 606 1.0E-15
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 528 606 1.0E-15
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 370 451 2.0E-15
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 521 608 2.0E-14
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 524 637 2.0E-14
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 528 603 2.0E-13
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 528 603 2.0E-13
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 528 606 5.0E-13
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 528 607 1.0E-12
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 375 460 2.0E-12
sp|F4JWB3|MYTM2_ARATH Phosphatidylinositol-3-phosphatase myotubularin-2 OS=Arabidopsis thaliana GN=MTM2 PE=1 SV=1 527 594 6.0E-12
sp|A2BGG1|MTMRC_DANRE Myotubularin-related protein 12 OS=Danio rerio GN=mtmr12 PE=3 SV=1 370 458 1.0E-11
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 527 723 9.0E-11
sp|Q9NXD2|MTMRA_HUMAN Myotubularin-related protein 10 OS=Homo sapiens GN=MTMR10 PE=1 SV=3 370 458 1.0E-10
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 527 606 4.0E-10
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 523 591 5.0E-10
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 74 220 2.0E-09
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 527 606 3.0E-09
sp|A0JMF6|MTMRA_DANRE Myotubularin-related protein 10 OS=Danio rerio GN=mtmr10 PE=2 SV=1 333 458 8.0E-09
sp|Q7TPM9|MTMRA_MOUSE Myotubularin-related protein 10 OS=Mus musculus GN=Mtmr10 PE=1 SV=2 370 458 1.0E-08
sp|Q5U581|MTRAA_XENLA Myotubularin-related protein 10-A OS=Xenopus laevis GN=mtmr10-a PE=2 SV=1 370 458 4.0E-08
sp|Q6NU08|MTRAB_XENLA Myotubularin-related protein 10-B OS=Xenopus laevis GN=mtmr10-b PE=2 SV=1 370 458 5.0E-08
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 528 594 2.0E-07
sp|Q5FVM6|MTMRC_RAT Myotubularin-related protein 12 OS=Rattus norvegicus GN=Mtmr12 PE=1 SV=2 369 458 4.0E-07
sp|Q9C0I1|MTMRC_HUMAN Myotubularin-related protein 12 OS=Homo sapiens GN=MTMR12 PE=1 SV=2 369 458 4.0E-07
sp|Q5R989|MTMRC_PONAB Myotubularin-related protein 12 OS=Pongo abelii GN=MTMR12 PE=2 SV=1 369 458 4.0E-07
sp|Q80TA6|MTMRC_MOUSE Myotubularin-related protein 12 OS=Mus musculus GN=Mtmr12 PE=1 SV=2 369 458 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|328
Ophiocordyceps australis map64 (Brazil) OphauB2|6927
Ophiocordyceps camponoti-floridani Ophcf2|01867
Ophiocordyceps camponoti-rufipedis Ophun1|6723 (this protein)
Ophiocordyceps kimflemingae Ophio5|8224
Ophiocordyceps subramaniannii Hirsu2|2351

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6723
MEARKVIDNVQGIYGGQSTNGVLRLTDFHLVFCAPVKQPEGTESESSPRPRERWLTYPILCYCALRPTPPSSRLA
PSIRIRCRDFTFVTFNFADNDAARLAFDFIFARTCKLGTVERLFAFHHKPLASEKGLNGWDIYDPRAEFRRQGIS
EKLADKGWRITSINKDYVFCDTYPAVLVVPTKISDNVLKYAREFRSRNRIPVLSYIHPVNNCTITRSSQPLAGIT
RKSNVQDEKLVAASFSAWMPGAADEPTPPVSQPETAGLEPDLSETERYEDELISRSAAMYDEKTGEQLVYGRQQT
NMIVDARPTINAIVNQVQGMGSENMDKYPFATKSFLNIDNIHAMRNSLNKVIEALKDADISPLPPNRELLHQSGW
LRHIHNVLDGSAIIARRIGIKHSHVLIHCSDGWDRTSQLSALAQIMLDPYFRTLEGFMVLVEKDWLSFGHMFRLR
SGHLSHEDWFVVQKDALAGSKVHPGDGDGRGDALQNVLSGAKRFFNQNKDDAELSSISEAASSHVVDDEATMPKM
VSPVFHQFLDCTYQLLRQSPNRFEFNERFLRRLLYHLYSCQYGTFLYNSEKQRQDARVSERTSSVWDYFLCRKAE
FTNPDYDGVIDDRVRGRERILLPSLKDIRWWHQLFGRTDDEMNGALNAAATAANDRQTAASSLSQATPKSSESPK
PESVLAAVETAHEPLTPSASAKVLSAALRDGLAGLDIGANEPAQQTTPRKQPSPDYALFRSGSPPETGEAVDRYA
HLRDPEPVWKSVCCVSAGSGHCRESSDHAGCGWAIVHEPDAPRSSCASDTASSLRESLSNDGDPTSSSVEEEPLG
VGGERLLTDGMCRD*
Coding >Ophun1|6723
ATGGAGGCCAGGAAGGTCATCGACAATGTTCAAGGCATCTACGGGGGCCAGAGCACCAACGGCGTCCTGCGCCTG
ACGGATTTTCACCTGGTATTCTGCGCACCCGTCAAGCAACCCGAAGGCACAGAATCCGAATCTTCGCCCCGGCCG
CGAGAACGCTGGCTCACCTACCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCCCGTCTGGCG
CCTTCGATCCGCATACGCTGCAGGGACTTTACTTTTGTCACCTTTAACTTTGCCGACAACGATGCTGCTCGCCTG
GCATTTGATTTTATATTTGCCAGGACTTGCAAGCTCGGTACGGTCGAGAGGCTTTTCGCCTTTCACCACAAGCCC
CTGGCCAGCGAAAAGGGCCTGAATGGCTGGGACATCTACGATCCCAGAGCAGAGTTCCGCCGGCAGGGCATCAGC
GAGAAACTCGCCGACAAGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCC
GTCTTGGTCGTCCCCACGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATT
CCGGTTCTATCCTACATCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTGGCTGGCATCACG
AGAAAGTCCAACGTTCAGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCAGCGGATGAG
CCGACTCCCCCTGTGAGCCAGCCAGAGACGGCCGGTTTGGAGCCAGACCTTTCTGAGACAGAGCGATATGAGGAT
GAGCTCATCTCGAGGTCGGCAGCCATGTACGATGAGAAGACAGGCGAGCAGCTCGTCTACGGACGTCAGCAGACC
AACATGATTGTCGACGCGCGTCCCACCATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAGAACATG
GACAAGTATCCGTTCGCCACAAAGTCTTTTCTCAACATCGACAACATTCATGCTATGCGCAACTCGCTCAACAAG
GTGATCGAGGCGCTCAAAGACGCCGACATATCGCCTCTCCCGCCCAACCGGGAGCTGCTGCACCAGAGCGGCTGG
CTCCGTCACATACACAACGTCCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCATTCTCACGTG
CTCATCCACTGCTCCGACGGCTGGGATCGGACGAGCCAGCTGAGCGCACTGGCCCAGATCATGCTGGATCCGTAC
TTCAGGACCCTCGAGGGCTTCATGGTCCTCGTTGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTACGT
TCTGGCCACCTCAGCCACGAAGACTGGTTCGTTGTACAAAAGGATGCCCTCGCCGGCTCAAAGGTTCATCCCGGC
GATGGAGACGGACGCGGCGACGCGCTGCAGAACGTTCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGAC
GACGCCGAGTTGTCGTCCATCAGCGAGGCGGCTTCCAGTCATGTGGTCGACGACGAGGCCACGATGCCAAAGATG
GTCAGCCCCGTCTTTCACCAGTTTCTCGACTGCACGTACCAGCTGCTGCGTCAGAGCCCGAACCGGTTCGAGTTC
AACGAGCGCTTCTTGCGTCGTCTGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCAGAG
AAGCAGCGGCAGGACGCCAGGGTCAGCGAGAGGACTTCTTCCGTCTGGGACTACTTCCTCTGCCGCAAGGCCGAG
TTCACGAATCCCGACTACGATGGCGTCATCGACGACCGCGTCAGGGGCCGCGAACGCATCCTACTGCCCAGCCTC
AAGGACATCCGATGGTGGCATCAGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCAGCGGCT
ACGGCGGCCAACGATCGCCAGACGGCAGCGTCGAGCCTCAGCCAGGCCACGCCCAAGTCGTCTGAGTCTCCCAAG
CCCGAATCCGTACTGGCTGCCGTGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCG
GCCGCCTTGCGCGACGGGCTCGCAGGCCTCGACATCGGCGCCAACGAGCCCGCTCAACAGACTACCCCTCGCAAA
CAACCCTCTCCGGACTATGCCCTGTTCCGCAGCGGCAGTCCCCCGGAGACAGGCGAGGCGGTAGATCGGTACGCG
CACCTGCGCGATCCCGAGCCCGTATGGAAGAGCGTCTGCTGCGTCTCGGCCGGCTCAGGCCATTGCCGCGAGTCG
TCGGATCACGCCGGCTGCGGATGGGCCATTGTTCATGAGCCCGACGCACCCCGCAGCTCTTGCGCCTCGGACACG
GCCTCGTCTCTGCGCGAGAGCCTCTCGAATGACGGAGATCCGACCAGCAGCAGCGTGGAGGAGGAACCGTTGGGC
GTCGGTGGCGAGCGTCTGCTGACGGATGGAATGTGCCGAGACTGA
Transcript >Ophun1|6723
ATGGAGGCCAGGAAGGTCATCGACAATGTTCAAGGCATCTACGGGGGCCAGAGCACCAACGGCGTCCTGCGCCTG
ACGGATTTTCACCTGGTATTCTGCGCACCCGTCAAGCAACCCGAAGGCACAGAATCCGAATCTTCGCCCCGGCCG
CGAGAACGCTGGCTCACCTACCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCCCGTCTGGCG
CCTTCGATCCGCATACGCTGCAGGGACTTTACTTTTGTCACCTTTAACTTTGCCGACAACGATGCTGCTCGCCTG
GCATTTGATTTTATATTTGCCAGGACTTGCAAGCTCGGTACGGTCGAGAGGCTTTTCGCCTTTCACCACAAGCCC
CTGGCCAGCGAAAAGGGCCTGAATGGCTGGGACATCTACGATCCCAGAGCAGAGTTCCGCCGGCAGGGCATCAGC
GAGAAACTCGCCGACAAGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCC
GTCTTGGTCGTCCCCACGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATT
CCGGTTCTATCCTACATCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTGGCTGGCATCACG
AGAAAGTCCAACGTTCAGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCAGCGGATGAG
CCGACTCCCCCTGTGAGCCAGCCAGAGACGGCCGGTTTGGAGCCAGACCTTTCTGAGACAGAGCGATATGAGGAT
GAGCTCATCTCGAGGTCGGCAGCCATGTACGATGAGAAGACAGGCGAGCAGCTCGTCTACGGACGTCAGCAGACC
AACATGATTGTCGACGCGCGTCCCACCATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAGAACATG
GACAAGTATCCGTTCGCCACAAAGTCTTTTCTCAACATCGACAACATTCATGCTATGCGCAACTCGCTCAACAAG
GTGATCGAGGCGCTCAAAGACGCCGACATATCGCCTCTCCCGCCCAACCGGGAGCTGCTGCACCAGAGCGGCTGG
CTCCGTCACATACACAACGTCCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCATTCTCACGTG
CTCATCCACTGCTCCGACGGCTGGGATCGGACGAGCCAGCTGAGCGCACTGGCCCAGATCATGCTGGATCCGTAC
TTCAGGACCCTCGAGGGCTTCATGGTCCTCGTTGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTACGT
TCTGGCCACCTCAGCCACGAAGACTGGTTCGTTGTACAAAAGGATGCCCTCGCCGGCTCAAAGGTTCATCCCGGC
GATGGAGACGGACGCGGCGACGCGCTGCAGAACGTTCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGAC
GACGCCGAGTTGTCGTCCATCAGCGAGGCGGCTTCCAGTCATGTGGTCGACGACGAGGCCACGATGCCAAAGATG
GTCAGCCCCGTCTTTCACCAGTTTCTCGACTGCACGTACCAGCTGCTGCGTCAGAGCCCGAACCGGTTCGAGTTC
AACGAGCGCTTCTTGCGTCGTCTGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCAGAG
AAGCAGCGGCAGGACGCCAGGGTCAGCGAGAGGACTTCTTCCGTCTGGGACTACTTCCTCTGCCGCAAGGCCGAG
TTCACGAATCCCGACTACGATGGCGTCATCGACGACCGCGTCAGGGGCCGCGAACGCATCCTACTGCCCAGCCTC
AAGGACATCCGATGGTGGCATCAGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCAGCGGCT
ACGGCGGCCAACGATCGCCAGACGGCAGCGTCGAGCCTCAGCCAGGCCACGCCCAAGTCGTCTGAGTCTCCCAAG
CCCGAATCCGTACTGGCTGCCGTGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCG
GCCGCCTTGCGCGACGGGCTCGCAGGCCTCGACATCGGCGCCAACGAGCCCGCTCAACAGACTACCCCTCGCAAA
CAACCCTCTCCGGACTATGCCCTGTTCCGCAGCGGCAGTCCCCCGGAGACAGGCGAGGCGGTAGATCGGTACGCG
CACCTGCGCGATCCCGAGCCCGTATGGAAGAGCGTCTGCTGCGTCTCGGCCGGCTCAGGCCATTGCCGCGAGTCG
TCGGATCACGCCGGCTGCGGATGGGCCATTGTTCATGAGCCCGACGCACCCCGCAGCTCTTGCGCCTCGGACACG
GCCTCGTCTCTGCGCGAGAGCCTCTCGAATGACGGAGATCCGACCAGCAGCAGCGTGGAGGAGGAACCGTTGGGC
GTCGGTGGCGAGCGTCTGCTGACGGATGGAATGTGCCGAGACTGA
Gene >Ophun1|6723
ATGGAGGCCAGGAAGGTAAAAACAGCTGCCTTGCTCCGTTCTTCTCTCGACCATGGTGGCCTGAAGCTCTCTAGG
TCATCGACAATGTTCAAGGCATCTACGGGGGCCAGAGCACCAACGGCGTCCTGCGCCTGACGGATTTTCACCTGG
TATTCTGCGCACCCGTCAAGCAACCCGAAGGCACAGAATCCGAATCTTCGCCCCGGCCGCGAGAACGCTGGCTCA
CCTACCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCCCGTCTGGCGCCTTCGATCCGCATAC
GCTGCAGGGACTTTACTTTTGTCACCTTTAACTTTGCCGACAACGATGCTGCTCGCCTGGCATTTGATTTTATAT
TTGCCAGGACTTGCAAGCTCGGTACGGTCGAGAGGCTTTTCGCCTTTCACCACAAGCCCCTGGCCAGCGAAAAGG
GCCTGAATGGCTGGGACATCTACGATCCCAGAGCAGAGTTCCGCCGGCAGGGCATCAGCGAGAAACTCGCCGACA
AGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCCGTCTTGGTCGTCCCCA
CGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATTCCGGTTCTATCCTACA
TCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTGGCTGGCATCACGAGAAAGTCCAACGTTC
AGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCAGCGGATGAGCCGACTCCCCCTGTGA
GCCAGCCAGAGACGGCCGGTTTGGAGCCAGACCTTTCTGAGACAGAGCGATATGAGGATGAGCTCATCTCGAGGT
CGGCAGCCATGTACGATGAGAAGACAGGCGAGCAGCTCGTCTACGGACGTCAGCAGACCAACATGATTGTCGACG
CGCGTCCCACCATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAGAACATGGACAAGTATCCGTTCG
CCACAAAGTCTTTTCTCAACATCGACAACATTCATGCTATGCGCAACTCGCTCAACAAGGTGATCGAGGCGCTCA
AAGACGCCGACATATCGCCTCTCCCGCCCAACCGGGAGCTGCTGCACCAGAGCGGCTGGCTCCGTCACATACACA
ACGTCCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCATTCTCACGTGCTCATCCACTGCTCCG
ACGGCTGGGATCGGACGAGCCAGCTGAGCGCACTGGCCCAGATCATGCTGGATCCGTACTTCAGGACCCTCGAGG
GCTTCATGGTCCTCGTTGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTACGTTCTGGCCACCTCAGCC
ACGAAGACTGGTTCGTTGTACAAAAGGATGCCCTCGCCGGCTCAAAGGTTCATCCCGGCGATGGAGACGGACGCG
GCGACGCGCTGCAGAACGTTCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGACGACGCCGAGTTGTCGT
CCATCAGCGAGGCGGCTTCCAGTCATGTGGTCGACGACGAGGCCACGATGCCAAAGATGGTCAGCCCCGTCTTTC
ACCAGTTTCTCGACTGCACGTACCAGCTGCTGCGTCAGAGCCCGAACCGGTTCGAGTTCAACGAGCGCTTCTTGC
GTCGTCTGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCAGAGAAGCAGCGGCAGGACG
CCAGGGTCAGCGAGAGGACTTCTTCCGTCTGGGACTACTTCCTCTGCCGCAAGGCCGAGTTCACGAATCCCGACT
ACGATGGCGTCATCGACGACCGCGTCAGGGGCCGCGAACGCATCCTACTGCCCAGCCTCAAGGACATCCGATGGT
GGCATCAGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCAGCGGCTACGGCGGCCAACGATC
GCCAGACGGCAGCGTCGAGCCTCAGCCAGGCCACGCCCAAGTCGTCTGAGTCTCCCAAGCCCGAATCCGTACTGG
CTGCCGTGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCGGCCGCCTTGCGCGACG
GGCTCGCAGGCCTCGACATCGGCGCCAACGAGCCCGCTCAACAGACTACCCCTCGCAGTGACCAGGAGCTGCAAG
AGATGACATAGGACGTCATAGAACAACCCTCTCCGGACTATGCCCTGTTCCGCAGCGGCAGTCCCCCGGAGACAG
GCGAGGCGGTAGATCGGTACGCGCACCTGCGCGATCCCGAGCCCGTATGGAAGAGCGTCTGCTGCGTCTCGGCCG
GCTCAGGCCATTGCCGCGAGTCGTCGGATCACGCCGGCTGCGGATGGGCCATTGTTCATGAGCCCGACGCACCCC
GCAGCTCTTGCGCCTCGGACACGGCCTCGTCTCTGCGCGAGAGCCTCTCGAATGACGGAGATCCGACCAGCAGCA
GCGTGGAGGAGGAACCGTTGGGCGTCGGTGGCGAGCGTCTGCTGACGGATGGAATGTGCCGAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail