Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6722
Gene name
LocationContig_76:38617..40580
Strand+
Gene length (bp)1963
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17759 tRNA_synthFbeta Phenylalanyl tRNA synthetase beta chain CLM domain 5.8E-45 375 600
PF18262 PhetRS_B1 Phe-tRNA synthetase beta subunit B1 domain 9.9E-28 1 85
PF03483 B3_4 B3/4 domain 2.8E-24 114 274
PF03484 B5 tRNA synthetase B5 domain 9.8E-13 307 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42849|SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs1 PE=3 SV=1 1 600 0.0E+00
sp|O13432|SYFB_CANAX Phenylalanine--tRNA ligase beta subunit OS=Candida albicans GN=FRS1 PE=2 SV=3 1 636 0.0E+00
sp|P15624|SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS1 PE=1 SV=3 1 636 0.0E+00
sp|Q9VCA5|SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster GN=beta-PheRS PE=1 SV=1 1 600 0.0E+00
sp|Q9WUA2|SYFB_MOUSE Phenylalanine--tRNA ligase beta subunit OS=Mus musculus GN=Farsb PE=1 SV=2 1 636 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42849|SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs1 PE=3 SV=1 1 600 0.0E+00
sp|O13432|SYFB_CANAX Phenylalanine--tRNA ligase beta subunit OS=Candida albicans GN=FRS1 PE=2 SV=3 1 636 0.0E+00
sp|P15624|SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS1 PE=1 SV=3 1 636 0.0E+00
sp|Q9VCA5|SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster GN=beta-PheRS PE=1 SV=1 1 600 0.0E+00
sp|Q9WUA2|SYFB_MOUSE Phenylalanine--tRNA ligase beta subunit OS=Mus musculus GN=Farsb PE=1 SV=2 1 636 0.0E+00
sp|Q9NSD9|SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens GN=FARSB PE=1 SV=3 1 636 0.0E+00
sp|Q5R7F7|SYFB_PONAB Phenylalanine--tRNA ligase beta subunit OS=Pongo abelii GN=FARSB PE=2 SV=1 1 636 0.0E+00
sp|Q9SGE9|SYFB_ARATH Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana GN=At1g72550 PE=2 SV=1 1 598 9.0E-178
sp|Q19713|SYFB_CAEEL Phenylalanine--tRNA ligase beta subunit OS=Caenorhabditis elegans GN=frs-2 PE=3 SV=2 1 636 2.0E-173
sp|Q550D2|SYFB_DICDI Phenylalanine--tRNA ligase beta subunit OS=Dictyostelium discoideum GN=phesB PE=3 SV=2 1 596 2.0E-161
sp|C4VA52|SYFB_NOSCE Probable phenylalanine--tRNA ligase beta subunit OS=Nosema ceranae (strain BRL01) GN=NCER_101490 PE=3 SV=1 1 512 1.0E-99
sp|Q8SS40|SYFB_ENCCU Probable phenylalanine--tRNA ligase beta subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0900 PE=3 SV=1 1 613 1.0E-97
sp|A9CS50|SYFB_ENTBH Probable phenylalanine--tRNA ligase beta subunit OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21956 PE=3 SV=1 1 598 5.0E-79
sp|A6UWT1|SYFB_META3 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pheT PE=3 SV=1 1 613 3.0E-66
sp|B1L7C0|SYFB_KORCO Phenylalanine--tRNA ligase beta subunit OS=Korarchaeum cryptofilum (strain OPF8) GN=pheT PE=3 SV=1 57 598 5.0E-61
sp|A0B993|SYFB_METTP Phenylalanine--tRNA ligase beta subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pheT PE=3 SV=1 54 613 5.0E-61
sp|Q58508|SYFB_METJA Phenylalanine--tRNA ligase beta subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pheT PE=3 SV=1 1 613 2.0E-60
sp|Q2NGX9|SYFB_METST Phenylalanine--tRNA ligase beta subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pheT PE=3 SV=1 1 609 1.0E-59
sp|A7I615|SYFB_METB6 Phenylalanine--tRNA ligase beta subunit OS=Methanoregula boonei (strain 6A8) GN=pheT PE=3 SV=1 60 598 5.0E-58
sp|A2ST82|SYFB_METLZ Phenylalanine--tRNA ligase beta subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pheT PE=3 SV=1 54 598 9.0E-58
sp|C6A237|SYFB_THESM Phenylalanine--tRNA ligase beta subunit OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pheT PE=3 SV=1 1 598 1.0E-57
sp|Q12YP2|SYFB_METBU Phenylalanine--tRNA ligase beta subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pheT PE=3 SV=1 112 613 1.0E-57
sp|O26864|SYFB_METTH Phenylalanine--tRNA ligase beta subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pheT PE=1 SV=2 27 598 2.0E-57
sp|O73984|SYFB_PYRHO Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pheT PE=1 SV=1 1 598 4.0E-57
sp|Q8U260|SYFB_PYRFU Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pheT PE=3 SV=1 1 599 1.0E-56
sp|A9AA58|SYFB_METM6 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pheT PE=3 SV=1 58 613 7.0E-56
sp|Q468N7|SYFB_METBF Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pheT PE=3 SV=1 54 613 8.0E-56
sp|Q2FLL1|SYFB_METHJ Phenylalanine--tRNA ligase beta subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pheT PE=3 SV=1 44 598 1.0E-55
sp|Q0W0X4|SYFB_METAR Phenylalanine--tRNA ligase beta subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pheT PE=3 SV=1 1 517 2.0E-55
sp|A6VGJ4|SYFB_METM7 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pheT PE=3 SV=1 53 518 2.0E-54
sp|Q8TPF7|SYFB_METAC Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pheT PE=3 SV=1 1 613 2.0E-54
sp|A4FWS3|SYFB_METM5 Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pheT PE=3 SV=1 50 518 6.0E-54
sp|Q6LXU2|SYFB_METMP Phenylalanine--tRNA ligase beta subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=pheT PE=3 SV=1 58 613 8.0E-54
sp|A6UPQ4|SYFB_METVS Phenylalanine--tRNA ligase beta subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pheT PE=3 SV=1 58 599 9.0E-54
sp|Q8PTA5|SYFB_METMA Phenylalanine--tRNA ligase beta subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pheT PE=3 SV=1 1 613 9.0E-54
sp|Q9UYX2|SYFB_PYRAB Phenylalanine--tRNA ligase beta subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pheT PE=3 SV=1 1 598 2.0E-53
sp|C5A5Z0|SYFB_THEGJ Phenylalanine--tRNA ligase beta subunit OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pheT PE=3 SV=1 1 598 5.0E-53
sp|B8GEX4|SYFB_METPE Phenylalanine--tRNA ligase beta subunit OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pheT PE=3 SV=1 35 529 3.0E-52
sp|Q8TX56|SYFB_METKA Phenylalanine--tRNA ligase beta subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pheT PE=3 SV=1 1 611 1.0E-51
sp|Q971D8|SYFB_SULTO Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pheT PE=3 SV=1 1 598 3.0E-51
sp|O28848|SYFB_ARCFU Phenylalanine--tRNA ligase beta subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pheT PE=3 SV=1 54 636 4.0E-51
sp|C3N028|SYFB_SULIA Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.16.27) GN=pheT PE=3 SV=1 1 598 2.0E-50
sp|P95960|SYFB_SULSO Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pheT PE=3 SV=1 1 598 5.0E-50
sp|C3MYY0|SYFB_SULIM Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pheT PE=3 SV=1 1 598 7.0E-50
sp|C4KJ68|SYFB_SULIK Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pheT PE=3 SV=1 1 598 7.0E-50
sp|B6YTJ3|SYFB_THEON Phenylalanine--tRNA ligase beta subunit OS=Thermococcus onnurineus (strain NA1) GN=pheT PE=3 SV=1 1 598 7.0E-50
sp|C3MJ88|SYFB_SULIL Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pheT PE=3 SV=1 1 598 8.0E-50
sp|Q76KA7|SYFB_THEKO Phenylalanine--tRNA ligase beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pheT PE=1 SV=1 1 598 1.0E-49
sp|C3N8B1|SYFB_SULIY Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pheT PE=3 SV=1 1 598 1.0E-49
sp|C3NMS5|SYFB_SULIN Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pheT PE=3 SV=1 1 598 1.0E-49
sp|B9LU47|SYFB_HALLT Phenylalanine--tRNA ligase beta subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pheT PE=3 SV=1 1 527 1.0E-48
sp|A3CT77|SYFB_METMJ Phenylalanine--tRNA ligase beta subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pheT PE=3 SV=1 35 598 6.0E-47
sp|Q4J8Q0|SYFB_SULAC Phenylalanine--tRNA ligase beta subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pheT PE=3 SV=1 1 619 2.0E-46
sp|A4YIL0|SYFB_METS5 Phenylalanine--tRNA ligase beta subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pheT PE=3 SV=1 1 521 2.0E-45
sp|Q9HMK3|SYFB_HALSA Phenylalanine--tRNA ligase beta subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pheT PE=3 SV=1 1 613 3.0E-43
sp|B0R807|SYFB_HALS3 Phenylalanine--tRNA ligase beta subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pheT PE=3 SV=1 1 613 3.0E-43
sp|Q3ITU5|SYFB_NATPD Phenylalanine--tRNA ligase beta subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pheT PE=3 SV=1 1 613 4.0E-41
sp|A1RYS1|SYFB_THEPD Phenylalanine--tRNA ligase beta subunit OS=Thermofilum pendens (strain Hrk 5) GN=pheT PE=3 SV=1 114 517 7.0E-40
sp|Q5UYF3|SYFB_HALMA Phenylalanine--tRNA ligase beta subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pheT PE=3 SV=1 1 517 1.0E-39
sp|Q0SMZ4|SYFB_BORAP Phenylalanine--tRNA ligase beta subunit OS=Borrelia afzelii (strain PKo) GN=pheT PE=3 SV=1 1 598 1.0E-38
sp|B5RPL7|SYFB_BORRA Phenylalanine--tRNA ligase beta subunit OS=Borrelia recurrentis (strain A1) GN=pheT PE=3 SV=1 1 544 3.0E-38
sp|Q97B53|SYFB_THEVO Phenylalanine--tRNA ligase beta subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pheT PE=3 SV=1 57 604 1.0E-37
sp|Q661A7|SYFB_BORBP Phenylalanine--tRNA ligase beta subunit OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=pheT PE=3 SV=1 1 529 3.0E-37
sp|B7J278|SYFB_BORBZ Phenylalanine--tRNA ligase beta subunit OS=Borrelia burgdorferi (strain ZS7) GN=pheT PE=3 SV=1 1 522 7.0E-36
sp|P94283|SYFB_BORBU Phenylalanine--tRNA ligase beta subunit OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pheT PE=3 SV=1 1 522 9.0E-36
sp|Q9Y9I3|SYFB_AERPE Phenylalanine--tRNA ligase beta subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pheT PE=3 SV=1 1 635 1.0E-35
sp|B5RM71|SYFB_BORDL Phenylalanine--tRNA ligase beta subunit OS=Borrelia duttonii (strain Ly) GN=pheT PE=3 SV=1 1 544 5.0E-35
sp|A1QZU9|SYFB_BORT9 Phenylalanine--tRNA ligase beta subunit OS=Borrelia turicatae (strain 91E135) GN=pheT PE=3 SV=1 1 546 7.0E-35
sp|B2S0L6|SYFB_BORHD Phenylalanine--tRNA ligase beta subunit OS=Borrelia hermsii (strain HS1 / DAH) GN=pheT PE=3 SV=1 57 540 4.0E-33
sp|B2S1W3|SYFB_TREPS Phenylalanine--tRNA ligase beta subunit OS=Treponema pallidum subsp. pallidum (strain SS14) GN=pheT PE=3 SV=1 1 603 4.0E-32
sp|O83059|SYFB_TREPA Phenylalanine--tRNA ligase beta subunit OS=Treponema pallidum (strain Nichols) GN=pheT PE=3 SV=1 1 603 4.0E-32
sp|Q8ZWQ7|SYFB_PYRAE Phenylalanine--tRNA ligase beta subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pheT PE=3 SV=1 1 519 1.0E-30
sp|P57694|SYFB_THEAC Phenylalanine--tRNA ligase beta subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pheT PE=3 SV=1 57 480 6.0E-30
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 103 270 2.0E-25
sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1 103 266 2.0E-25
sp|Q6G5I2|SYFB_BARHE Phenylalanine--tRNA ligase beta subunit OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pheT PE=3 SV=1 302 602 9.0E-13
sp|Q5KWE5|SYFB_GEOKA Phenylalanine--tRNA ligase beta subunit OS=Geobacillus kaustophilus (strain HTA426) GN=pheT PE=3 SV=1 58 604 2.0E-12
sp|Q6G0Y3|SYFB_BARQU Phenylalanine--tRNA ligase beta subunit OS=Bartonella quintana (strain Toulouse) GN=pheT PE=3 SV=1 302 602 1.0E-11
sp|Q39VS4|SYFB_GEOMG Phenylalanine--tRNA ligase beta subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pheT PE=3 SV=1 219 604 2.0E-10
sp|P17922|SYFB_BACSU Phenylalanine--tRNA ligase beta subunit OS=Bacillus subtilis (strain 168) GN=pheT PE=3 SV=2 305 604 2.0E-10
sp|Q2JHU3|SYFB_SYNJB Phenylalanine--tRNA ligase beta subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pheT PE=3 SV=1 292 479 4.0E-10
sp|Q8RHB5|SYFB_FUSNN Phenylalanine--tRNA ligase beta subunit OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pheT PE=3 SV=1 218 626 7.0E-10
sp|Q9I0A4|SYFB_PSEAE Phenylalanine--tRNA ligase beta subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pheT PE=1 SV=1 347 604 9.0E-10
sp|Q5M3S7|SYFB_STRT2 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pheT PE=3 SV=2 300 502 1.0E-09
sp|Q5LZ72|SYFB_STRT1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pheT PE=3 SV=2 300 502 1.0E-09
sp|Q720K7|SYFB_LISMF Phenylalanine--tRNA ligase beta subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pheT PE=3 SV=1 58 625 1.0E-09
sp|P47437|SYFB_MYCGE Phenylalanine--tRNA ligase beta subunit OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pheT PE=3 SV=1 226 600 1.0E-09
sp|Q30Y16|SYFB_DESAG Phenylalanine--tRNA ligase beta subunit OS=Desulfovibrio alaskensis (strain G20) GN=pheT PE=3 SV=1 321 559 2.0E-09
sp|Q97GL0|SYFB_CLOAB Phenylalanine--tRNA ligase beta subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pheT PE=3 SV=1 56 632 2.0E-09
sp|Q92CI6|SYFB_LISIN Phenylalanine--tRNA ligase beta subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pheT PE=3 SV=1 343 604 2.0E-09
sp|Q8Y7Q1|SYFB_LISMO Phenylalanine--tRNA ligase beta subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pheT PE=3 SV=1 58 604 2.0E-09
sp|Q836J5|SYFB_ENTFA Phenylalanine--tRNA ligase beta subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pheT PE=3 SV=1 346 521 3.0E-09
sp|Q6MEA6|SYFB_PARUW Phenylalanine--tRNA ligase beta subunit OS=Protochlamydia amoebophila (strain UWE25) GN=pheT PE=3 SV=2 209 604 3.0E-09
sp|Q3K1I7|SYFB_STRA1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pheT PE=3 SV=1 300 475 4.0E-09
sp|Q5NG54|SYFB_FRATT Phenylalanine--tRNA ligase beta subunit OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pheT PE=3 SV=1 311 600 4.0E-09
sp|Q8E5U1|SYFB_STRA3 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pheT PE=3 SV=1 300 475 4.0E-09
sp|Q8E064|SYFB_STRA5 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pheT PE=3 SV=1 300 475 4.0E-09
sp|Q8AA39|SYFB_BACTN Phenylalanine--tRNA ligase beta subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pheT PE=3 SV=1 345 609 4.0E-09
sp|Q9K896|SYFB_BACHD Phenylalanine--tRNA ligase beta subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pheT PE=3 SV=1 310 521 5.0E-09
sp|Q2JXF6|SYFB_SYNJA Phenylalanine--tRNA ligase beta subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=pheT PE=3 SV=1 292 598 6.0E-09
sp|Q8R9C7|SYFB_CALS4 Phenylalanine--tRNA ligase beta subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pheT PE=3 SV=1 189 598 6.0E-09
sp|Q97S34|SYFB_STRPN Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pheT PE=3 SV=1 341 475 7.0E-09
sp|Q3KEX7|SYFB_PSEPF Phenylalanine--tRNA ligase beta subunit OS=Pseudomonas fluorescens (strain Pf0-1) GN=pheT PE=3 SV=1 4 624 1.0E-08
sp|Q5GXY5|SYFB_XANOR Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pheT PE=3 SV=1 27 508 1.0E-08
sp|Q9CEB5|SYFB_LACLA Phenylalanine--tRNA ligase beta subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pheT PE=3 SV=1 208 479 1.0E-08
sp|Q8CWX2|SYFB_STRMU Phenylalanine--tRNA ligase beta subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pheT PE=3 SV=1 308 475 1.0E-08
sp|Q2P100|SYFB_XANOM Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pheT PE=3 SV=1 339 508 2.0E-08
sp|Q2IJB3|SYFB_ANADE Phenylalanine--tRNA ligase beta subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pheT PE=3 SV=1 316 604 2.0E-08
sp|Q98CQ1|SYFB_RHILO Phenylalanine--tRNA ligase beta subunit OS=Rhizobium loti (strain MAFF303099) GN=pheT PE=3 SV=1 189 602 2.0E-08
sp|Q83C15|SYFB_COXBU Phenylalanine--tRNA ligase beta subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pheT PE=3 SV=1 340 604 3.0E-08
sp|Q3ABT5|SYFB_CARHZ Phenylalanine--tRNA ligase beta subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pheT PE=3 SV=1 347 600 3.0E-08
sp|Q38VV4|SYFB_LACSS Phenylalanine--tRNA ligase beta subunit OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pheT PE=3 SV=1 300 458 3.0E-08
sp|Q5LC76|SYFB_BACFN Phenylalanine--tRNA ligase beta subunit OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pheT PE=1 SV=1 339 609 5.0E-08
sp|Q64T65|SYFB_BACFR Phenylalanine--tRNA ligase beta subunit OS=Bacteroides fragilis (strain YCH46) GN=pheT PE=3 SV=1 339 609 5.0E-08
sp|Q2YX86|SYFB_STAAB Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pheT PE=3 SV=1 167 528 6.0E-08
sp|Q6AGD6|SYFB_LEIXX Phenylalanine--tRNA ligase beta subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pheT PE=3 SV=1 309 486 6.0E-08
sp|Q6HCW8|SYFB_BACHK Phenylalanine--tRNA ligase beta subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pheT PE=3 SV=1 299 604 7.0E-08
sp|Q81L31|SYFB_BACAN Phenylalanine--tRNA ligase beta subunit OS=Bacillus anthracis GN=pheT PE=3 SV=1 299 604 7.0E-08
sp|Q48UC5|SYFB_STRPM Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pheT PE=3 SV=1 300 502 8.0E-08
sp|Q65GD3|SYFB_BACLD Phenylalanine--tRNA ligase beta subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pheT PE=3 SV=1 299 521 8.0E-08
sp|Q8NX60|SYFB_STAAW Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MW2) GN=pheT PE=3 SV=1 167 528 9.0E-08
sp|Q9AGR3|SYFB_STAAU Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus GN=pheT PE=3 SV=1 167 528 9.0E-08
sp|Q6GA75|SYFB_STAAS Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MSSA476) GN=pheT PE=3 SV=1 167 528 9.0E-08
sp|Q47N76|SYFB_THEFY Phenylalanine--tRNA ligase beta subunit OS=Thermobifida fusca (strain YX) GN=pheT PE=3 SV=1 328 634 9.0E-08
sp|Q9A0I0|SYFB_STRP1 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M1 GN=pheT PE=3 SV=1 300 502 9.0E-08
sp|Q6GHU6|SYFB_STAAR Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain MRSA252) GN=pheT PE=3 SV=1 167 528 9.0E-08
sp|Q5HGU5|SYFB_STAAC Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain COL) GN=pheT PE=3 SV=1 167 528 9.0E-08
sp|Q8DQT6|SYFB_STRR6 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pheT PE=3 SV=1 341 475 1.0E-07
sp|P67041|SYFB_STAAN Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain N315) GN=pheT PE=1 SV=1 167 528 1.0E-07
sp|P67040|SYFB_STAAM Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pheT PE=3 SV=1 167 528 1.0E-07
sp|Q5XCX3|SYFB_STRP6 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pheT PE=1 SV=2 300 502 1.0E-07
sp|Q3BRU2|SYFB_XANC5 Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pheT PE=3 SV=1 346 508 1.0E-07
sp|Q8P1K0|SYFB_STRP8 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pheT PE=3 SV=1 300 502 1.0E-07
sp|Q8PJE5|SYFB_XANAC Phenylalanine--tRNA ligase beta subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pheT PE=3 SV=1 346 508 1.0E-07
sp|Q633N5|SYFB_BACCZ Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ZK / E33L) GN=pheT PE=3 SV=1 299 604 1.0E-07
sp|Q3AQC6|SYFB_CHLCH Phenylalanine--tRNA ligase beta subunit OS=Chlorobium chlorochromatii (strain CaD3) GN=pheT PE=3 SV=1 217 479 1.0E-07
sp|Q72ZI2|SYFB_BACC1 Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pheT PE=3 SV=1 299 604 1.0E-07
sp|P0DG53|SYFB_STRPQ Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pheT PE=3 SV=1 284 502 2.0E-07
sp|P0DG52|SYFB_STRP3 Phenylalanine--tRNA ligase beta subunit OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pheT PE=3 SV=1 284 502 2.0E-07
sp|O88054|SYFB_STRCO Phenylalanine--tRNA ligase beta subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pheT PE=3 SV=1 291 498 2.0E-07
sp|Q817I7|SYFB_BACCR Phenylalanine--tRNA ligase beta subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pheT PE=3 SV=1 299 604 2.0E-07
sp|Q57AD9|SYFB_BRUAB Phenylalanine--tRNA ligase beta subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=pheT PE=3 SV=1 3 491 3.0E-07
sp|Q2YQV4|SYFB_BRUA2 Phenylalanine--tRNA ligase beta subunit OS=Brucella abortus (strain 2308) GN=pheT PE=3 SV=1 3 491 3.0E-07
sp|Q8YE74|SYFB_BRUME Phenylalanine--tRNA ligase beta subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pheT PE=3 SV=1 56 491 5.0E-07
sp|Q8DL37|SYFB_THEEB Phenylalanine--tRNA ligase beta subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=pheT PE=3 SV=2 322 484 5.0E-07
sp|Q8FXX4|SYFB_BRUSU Phenylalanine--tRNA ligase beta subunit OS=Brucella suis biovar 1 (strain 1330) GN=pheT PE=3 SV=1 3 491 5.0E-07
sp|Q2LR26|SYFB_SYNAS Phenylalanine--tRNA ligase beta subunit OS=Syntrophus aciditrophicus (strain SB) GN=pheT PE=3 SV=1 305 630 6.0E-07
sp|Q74CZ9|SYFB_GEOSL Phenylalanine--tRNA ligase beta subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pheT PE=3 SV=1 291 604 6.0E-07
sp|Q2FHU2|SYFB_STAA3 Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus aureus (strain USA300) GN=pheT PE=3 SV=1 167 528 8.0E-07
sp|Q4FNH4|SYFB_PELUB Phenylalanine--tRNA ligase beta subunit OS=Pelagibacter ubique (strain HTCC1062) GN=pheT PE=3 SV=1 315 599 9.0E-07
sp|Q828C6|SYFB_STRAW Phenylalanine--tRNA ligase beta subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pheT PE=3 SV=1 267 634 1.0E-06
sp|Q49WQ6|SYFB_STAS1 Phenylalanine--tRNA ligase beta subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pheT PE=3 SV=1 308 525 1.0E-06
sp|Q6ANC2|SYFB_DESPS Phenylalanine--tRNA ligase beta subunit OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pheT PE=3 SV=1 312 479 1.0E-06
sp|P74296|SYFB_SYNY3 Phenylalanine--tRNA ligase beta subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pheT PE=3 SV=1 311 512 2.0E-06
sp|Q67QF2|SYFB_SYMTH Phenylalanine--tRNA ligase beta subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pheT PE=3 SV=1 322 479 3.0E-06
sp|Q04VV0|SYFB_LEPBJ Phenylalanine--tRNA ligase beta subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pheT PE=3 SV=1 296 604 4.0E-06
sp|Q04XL9|SYFB_LEPBL Phenylalanine--tRNA ligase beta subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pheT PE=3 SV=1 296 604 4.0E-06
sp|Q3A4N8|SYFB_PELCD Phenylalanine--tRNA ligase beta subunit OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pheT PE=3 SV=1 299 604 5.0E-06
sp|Q88WR2|SYFB_LACPL Phenylalanine--tRNA ligase beta subunit OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pheT PE=3 SV=1 299 502 5.0E-06
sp|Q5HAU7|SYFB_EHRRW Phenylalanine--tRNA ligase beta subunit OS=Ehrlichia ruminantium (strain Welgevonden) GN=pheT PE=3 SV=1 146 468 6.0E-06
sp|Q87AB6|SYFB_XYLFT Phenylalanine--tRNA ligase beta subunit OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pheT PE=3 SV=1 347 508 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004826 phenylalanine-tRNA ligase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0003723 RNA binding Yes
GO:0006432 phenylalanyl-tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0019752 carboxylic acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0043038 amino acid activation No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004812 aminoacyl-tRNA ligase activity No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0000166 nucleotide binding No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043039 tRNA aminoacylation No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006082 organic acid metabolic process No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|327
Ophiocordyceps australis map64 (Brazil) OphauB2|6926
Ophiocordyceps camponoti-floridani Ophcf2|01866
Ophiocordyceps camponoti-rufipedis Ophun1|6722 (this protein)
Ophiocordyceps kimflemingae Ophio5|8225
Ophiocordyceps subramaniannii Hirsu2|2352

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6722
MPTISVDKYKLYEALGQKFTRAEFESLCFDYGIELDADTEEDEDERPMINGVREPPQLKIEIPANRYDMLCFEGL
VLNLNVFRGRTPPPNFSVVAPKDEKQQTITVKPDTARIRPYVAGAVLRNIKFTQDRYDSFIALQDKLHQNLARNR
TLVSMGTHDFDTVHGPFTYEALPPQDIKFAPLNQTKEVDGNELMTLYENDRHLGRYLHIIRDSPVYPVIYDANRV
VCSLPPIINSDHSKITVKTTNVFIEITATDMTKLQIVTDMLVTMFSVYCAEPFTVEPVRIISDHNGLSRVTPSLK
PRMTHAEVDYLNSCTGLNESRESLCKLLAKMAYVSRPSDQDANLLEIAIPPTRADVLHQCDIMEDLAVCYGFNKL
PRTAPARSATVGAPLMINKLSDIVRIEAAMAGWTEVMPLILCSHDENFSFLNRHDHGKTAVRLANPKTLEYQVVR
TSLLPGLLKTIRENKGHSLPIKIFEAADVVFKDDSLERRARNERHFAAAWCGKTSGFQVVHGLLDRLLLMLRTAF
LTREEGLASGGKSVDYSVHQSPDKADGYWIEELDDQVFFHGHAAAVHLRLGGRDRRIGEFGILHPSVLEKFDIRS
VLFFPYVGWAFALLTRVTRLVRYPVSTLEINLEVFL*
Coding >Ophun1|6722
ATGCCCACGATATCCGTCGACAAATACAAACTCTACGAGGCCCTCGGCCAAAAATTCACGAGGGCCGAGTTCGAG
AGCCTCTGCTTCGACTATGGAATCGAGCTCGACGCCGACACGGAAGAAGATGAGGACGAGCGGCCCATGATTAAT
GGCGTCCGAGAACCTCCCCAGCTTAAAATCGAGATACCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCCTC
GTGCTCAACCTCAACGTCTTCCGCGGCCGCACTCCTCCGCCAAACTTCTCAGTAGTCGCCCCCAAGGACGAGAAG
CAGCAGACAATCACCGTCAAGCCCGACACGGCCAGGATCCGGCCCTACGTCGCCGGCGCCGTCCTGCGCAATATC
AAGTTTACGCAGGACCGCTATGACTCCTTCATCGCCCTGCAGGACAAGCTACACCAGAACCTGGCGCGCAACCGC
ACGCTGGTGTCTATGGGTACTCACGATTTCGACACCGTCCACGGGCCCTTTACCTACGAGGCGCTCCCGCCGCAG
GACATCAAGTTTGCGCCACTCAACCAGACAAAGGAGGTCGACGGCAACGAGTTGATGACTCTGTACGAAAACGAC
AGACATCTCGGTCGTTATCTGCACATCATTCGCGATTCGCCCGTCTACCCGGTCATCTACGACGCCAACCGTGTC
GTCTGCTCCCTCCCCCCCATCATCAACAGCGACCACTCCAAGATAACGGTCAAGACGACAAACGTCTTCATCGAA
ATCACAGCCACGGACATGACCAAGCTTCAAATCGTCACTGACATGCTCGTCACCATGTTCTCCGTCTACTGCGCC
GAGCCCTTCACCGTCGAGCCCGTCCGCATCATATCAGATCACAACGGCCTCAGCCGCGTGACGCCCTCGCTCAAG
CCCAGGATGACGCACGCCGAGGTAGACTATCTCAACAGCTGCACCGGACTGAACGAATCCCGTGAGAGCCTTTGC
AAGCTGCTCGCCAAGATGGCCTACGTCTCCCGTCCTTCAGATCAGGACGCCAACCTGCTGGAGATTGCCATCCCC
CCAACGCGCGCAGACGTCCTCCATCAGTGCGACATCATGGAAGACCTCGCCGTCTGCTACGGCTTCAACAAGCTG
CCCCGAACAGCACCGGCCCGAAGCGCCACCGTCGGCGCACCCCTCATGATCAACAAGCTCAGCGACATCGTCCGC
ATCGAGGCCGCCATGGCCGGCTGGACCGAAGTCATGCCGCTCATCCTCTGCAGCCACGACGAAAACTTCAGCTTC
CTCAACCGTCACGACCATGGCAAGACGGCCGTCCGGCTGGCCAACCCCAAGACGCTCGAGTACCAGGTCGTCCGC
ACCTCGCTGCTGCCAGGCCTCCTCAAGACAATCCGCGAGAACAAGGGCCACAGCCTCCCCATCAAGATCTTCGAA
GCCGCCGACGTCGTCTTCAAGGACGACTCTCTCGAGCGTCGCGCCCGCAACGAGCGTCACTTCGCCGCCGCCTGG
TGCGGCAAGACGAGCGGCTTCCAGGTCGTACACGGTCTCCTCGACCGCCTTCTCCTCATGCTGCGCACCGCCTTT
TTGACCCGCGAGGAGGGTCTAGCCAGCGGCGGCAAGAGCGTCGACTATTCCGTCCACCAGTCGCCAGACAAGGCC
GACGGCTACTGGATCGAGGAACTCGACGACCAAGTCTTCTTCCACGGCCACGCCGCCGCCGTCCACCTGCGTCTG
GGCGGTCGAGATCGCCGCATCGGCGAGTTCGGCATCCTGCACCCTTCCGTGCTGGAAAAGTTTGACATCAGGTCG
GTTCTGTTCTTCCCCTACGTCGGCTGGGCCTTTGCTTTGCTGACTCGCGTTACACGTCTGGTTAGATACCCCGTC
AGCACTCTCGAGATCAACCTCGAGGTTTTCTTATAG
Transcript >Ophun1|6722
ATGCCCACGATATCCGTCGACAAATACAAACTCTACGAGGCCCTCGGCCAAAAATTCACGAGGGCCGAGTTCGAG
AGCCTCTGCTTCGACTATGGAATCGAGCTCGACGCCGACACGGAAGAAGATGAGGACGAGCGGCCCATGATTAAT
GGCGTCCGAGAACCTCCCCAGCTTAAAATCGAGATACCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCCTC
GTGCTCAACCTCAACGTCTTCCGCGGCCGCACTCCTCCGCCAAACTTCTCAGTAGTCGCCCCCAAGGACGAGAAG
CAGCAGACAATCACCGTCAAGCCCGACACGGCCAGGATCCGGCCCTACGTCGCCGGCGCCGTCCTGCGCAATATC
AAGTTTACGCAGGACCGCTATGACTCCTTCATCGCCCTGCAGGACAAGCTACACCAGAACCTGGCGCGCAACCGC
ACGCTGGTGTCTATGGGTACTCACGATTTCGACACCGTCCACGGGCCCTTTACCTACGAGGCGCTCCCGCCGCAG
GACATCAAGTTTGCGCCACTCAACCAGACAAAGGAGGTCGACGGCAACGAGTTGATGACTCTGTACGAAAACGAC
AGACATCTCGGTCGTTATCTGCACATCATTCGCGATTCGCCCGTCTACCCGGTCATCTACGACGCCAACCGTGTC
GTCTGCTCCCTCCCCCCCATCATCAACAGCGACCACTCCAAGATAACGGTCAAGACGACAAACGTCTTCATCGAA
ATCACAGCCACGGACATGACCAAGCTTCAAATCGTCACTGACATGCTCGTCACCATGTTCTCCGTCTACTGCGCC
GAGCCCTTCACCGTCGAGCCCGTCCGCATCATATCAGATCACAACGGCCTCAGCCGCGTGACGCCCTCGCTCAAG
CCCAGGATGACGCACGCCGAGGTAGACTATCTCAACAGCTGCACCGGACTGAACGAATCCCGTGAGAGCCTTTGC
AAGCTGCTCGCCAAGATGGCCTACGTCTCCCGTCCTTCAGATCAGGACGCCAACCTGCTGGAGATTGCCATCCCC
CCAACGCGCGCAGACGTCCTCCATCAGTGCGACATCATGGAAGACCTCGCCGTCTGCTACGGCTTCAACAAGCTG
CCCCGAACAGCACCGGCCCGAAGCGCCACCGTCGGCGCACCCCTCATGATCAACAAGCTCAGCGACATCGTCCGC
ATCGAGGCCGCCATGGCCGGCTGGACCGAAGTCATGCCGCTCATCCTCTGCAGCCACGACGAAAACTTCAGCTTC
CTCAACCGTCACGACCATGGCAAGACGGCCGTCCGGCTGGCCAACCCCAAGACGCTCGAGTACCAGGTCGTCCGC
ACCTCGCTGCTGCCAGGCCTCCTCAAGACAATCCGCGAGAACAAGGGCCACAGCCTCCCCATCAAGATCTTCGAA
GCCGCCGACGTCGTCTTCAAGGACGACTCTCTCGAGCGTCGCGCCCGCAACGAGCGTCACTTCGCCGCCGCCTGG
TGCGGCAAGACGAGCGGCTTCCAGGTCGTACACGGTCTCCTCGACCGCCTTCTCCTCATGCTGCGCACCGCCTTT
TTGACCCGCGAGGAGGGTCTAGCCAGCGGCGGCAAGAGCGTCGACTATTCCGTCCACCAGTCGCCAGACAAGGCC
GACGGCTACTGGATCGAGGAACTCGACGACCAAGTCTTCTTCCACGGCCACGCCGCCGCCGTCCACCTGCGTCTG
GGCGGTCGAGATCGCCGCATCGGCGAGTTCGGCATCCTGCACCCTTCCGTGCTGGAAAAGTTTGACATCAGGTCG
GTTCTGTTCTTCCCCTACGTCGGCTGGGCCTTTGCTTTGCTGACTCGCGTTACACGTCTGGTTAGATACCCCGTC
AGCACTCTCGAGATCAACCTCGAGGTTTTCTTATAG
Gene >Ophun1|6722
ATGCCCACGATATCCGTCGACAAATACAAACTCTACGAGGCCCTCGGCCAAAAGTACGACGACGAATCCCTCCCC
AGATCCCATCCCGTTGACAGAACATGGCAGATTCACGAGGGCCGAGTTCGAGAGCCTCTGCTTCGACTATGGAAT
CGAGCTCGACGCCGACACGGAAGAAGATGAGGACGAGCGGCCCATGATTAATGGCGTCCGAGAACCTCCCCAGCT
TAAAATCGAGATACCCGCCAACCGCTACGACATGCTCTGCTTCGAGGGCCTCGTGCTCAACCTCAACGTCTTCCG
CGGCCGCACTCCTCCGCCAAACTTCTCAGTAGTCGCCCCCAAGGACGAGAAGCAGCAGACAATCACCGTCAAGCC
CGACACGGCCAGGATCCGGCCCTACGTCGCCGGCGCCGTCCTGCGCAATATCAAGTTTACGCAGGACCGCTATGA
CTCCTTCATCGCCCTGCAGGACAAGCTACACCAGAACCTGGCGCGCAACCGCACGCTGGTGTCTATGGGTACTCA
CGATTTCGACACCGTCCACGGGCCCTTTACCTACGAGGCGCTCCCGCCGCAGGACATCAAGTTTGCGCCACTCAA
CCAGACAAAGGAGGTCGACGGCAACGAGTTGATGACTCTGTACGAAAACGACAGACATCTCGGTCGTTATCTGCA
CATCATTCGCGATTCGCCCGTCTACCCGGTCATCTACGACGCCAACCGTGTCGTCTGCTCCCTCCCCCCCATCAT
CAACAGCGACCACTCCAAGATAACGGTCAAGACGACAAACGTCTTCATCGAAATCACAGCCACGGACATGACCAA
GCTTCAAATCGTCACTGACATGCTCGTCACCATGTTCTCCGTCTACTGCGCCGAGCCCTTCACCGTCGAGCCCGT
CCGCATCATATCAGATCACAACGGCCTCAGCCGCGTGACGCCCTCGCTCAAGCCCAGGATGACGCACGCCGAGGT
AGACTATCTCAACAGCTGCACCGGACTGAACGAATCCCGTGAGAGCCTTTGCAAGCTGCTCGCCAAGATGGCCTA
CGTCTCCCGTCCTTCAGATCAGGACGCCAACCTGCTGGAGATTGCCATCCCCCCAACGCGCGCAGACGTCCTCCA
TCAGTGCGACATCATGGAAGACCTCGCCGTCTGCTACGGCTTCAACAAGCTGCCCCGAACAGCACCGGCCCGAAG
CGCCACCGTCGGCGCACCCCTCATGATCAACAAGCTCAGCGACATCGTCCGCATCGAGGCCGCCATGGCCGGCTG
GACCGAAGTCATGCCGCTCATCCTCTGCAGCCACGACGAAAACTTCAGCTTCCTCAACCGTCACGACCATGGCAA
GACGGCCGTCCGGCTGGCCAACCCCAAGACGCTCGAGTACCAGGTCGTCCGCACCTCGCTGCTGCCAGGCCTCCT
CAAGACAATCCGCGAGAACAAGGGCCACAGCCTCCCCATCAAGATCTTCGAAGCCGCCGACGTCGTCTTCAAGGA
CGACTCTCTCGAGCGTCGCGCCCGCAACGAGCGTCACTTCGCCGCCGCCTGGTGCGGCAAGACGAGCGGCTTCCA
GGTCGTACACGGTCTCCTCGACCGCCTTCTCCTCATGCTGCGCACCGCCTTTTTGACCCGCGAGGAGGGTCTAGC
CAGCGGCGGCAAGAGCGTCGACTATTCCGTCCACCAGTCGCCAGACAAGGCCGACGGCTACTGGATCGAGGAACT
CGACGACCAAGTCTTCTTCCACGGCCACGCCGCCGCCGTCCACCTGCGTCTGGGCGGTCGAGATCGCCGCATCGG
CGAGTTCGGCATCCTGCACCCTTCCGTGCTGGAAAAGTTTGACATCAGGTCGGTTCTGTTCTTCCCCTACGTCGG
CTGGGCCTTTGCTTTGCTGACTCGCGTTACACGTCTGGTTAGATACCCCGTCAGCACTCTCGAGATCAACCTCGA
GGTTTTCTTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail