Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|672
Gene name
LocationContig_121:16911..20401
Strand+
Gene length (bp)3490
Transcript length (bp)3423
Coding sequence length (bp)3423
Protein length (aa) 1141

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 1.4E-106 361 985

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 505 860 4.0E-18
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 538 887 2.0E-14
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 480 860 3.0E-14
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 362 860 8.0E-12
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 505 860 3.0E-11

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0003674 molecular_function No
GO:0097747 RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4865
Ophiocordyceps australis map64 (Brazil) OphauB2|262
Ophiocordyceps camponoti-floridani Ophcf2|07006
Ophiocordyceps camponoti-rufipedis Ophun1|672 (this protein)
Ophiocordyceps kimflemingae Ophio5|6681
Ophiocordyceps subramaniannii Hirsu2|7000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|672
MASSEGLKRIINSLNADYGLSIRRMDVTLSPRKARNRMQASADDENFQAEKLYSFIQRLYYHDLSQLSAAIGRFR
QLAADLLGSSVSFAGSAQRRRLLMSRLLDVLDGKVPMSNSKRSSEDDDEDESRSKRPKSRDAVDCGPDMVDLLPV
RSSPPPDTMDSISSRILSKKSSPSILTYFQSSRATIPSSSSRTSVASTVMEDDYPVSGDLLLSSQDYRDLLDKMD
RIPNSTGATPQSFSFKSSASTPRIESLEQKFKRLWPKVCVRGLDMAPLPVLWEVTRIFQHCQVESETCNLAYDEG
WVDQHLLRRTLAGHPSFAGKALPVASDSKAWALACRGLLNKTHQVCFSAELVMRPVARGLFPLEMRLNPLTLEPS
HRLARRFGADRCLEVTIPDPLYLEKELRKAAGGDSSFQIRFNRWLHNGHLHPFASRLWFPYFFSRKKSQGPAMYR
IYFFASDGHYFRESPVGALPPPGEASDPLSRTKVRPEGLLDWAIAIKRPENLAMSAVKLFSRLSISHTRTFCNVE
LSREQIRFLKKDVGTHEVMNDGLGRMSKALARKIADNLGLSDTPSGYQGRIGSAKGFWIIDVESDLNDGDIWIEL
YPSQIKWLCDFDDISHRTFEVKDYPREAKPGAALNQQFLPLLEAQARDRLAMRRHLEQTLRTNLVADLDALDGAL
DGPYDLRLWLRQVGPTSSSYGGPSFLAGLPRTCEDQVAQLLDAGFQPRRQQYMYDQCLHIATRKAETLRKSKLHV
SVAQATYLFMVADFWGVLEEGQVSVNFSSKFEADGFCDTALDGLNVLVARNPAHTLSDMQKVMTVAHPKLRRLKD
VIVFSTKGTTPLAALLSGGDYDGDKCWVCWDRNIVDNFQGCLADEQAETLKMTKLEITVDQLIPAVGRERHWKSL
CNKFTFLGFQFSFQPDMLGKCTKYKERLDYLRGVTGPHMSKLTALLSNLVDQAKQGVIFNEPKWKTFCEEELQLG
LWLDDPAYFEERCEKPDRLGDHSPLLDVLKFKVAKPAIDDSLEKLTGAMRAHKDTLQYYDADLTALYRRFDARRR
ECPVIHQLLTDLRNDLEVVAVEWATKSQSKDEKFITNCQEVFASWLAVEPRPELQASGQLKRILWDWDPNVSARR
LRVMSEWNRLKASAT*
Coding >Ophun1|672
ATGGCTTCGTCGGAGGGACTGAAGCGCATCATCAACAGTCTCAACGCCGATTACGGTCTCTCTATTCGGAGGATG
GATGTCACTCTCTCGCCGCGCAAGGCCAGGAATAGGATGCAGGCCTCGGCTGACGACGAGAACTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCAACGTCTGTACTATCACGACTTGAGTCAGCTGTCGGCAGCCATCGGCAGGTTCCGT
CAGCTGGCAGCCGATCTCCTCGGCTCGTCCGTCTCCTTCGCCGGCTCGGCTCAGCGGAGACGCCTTCTCATGAGC
CGTCTGCTCGATGTATTGGATGGAAAGGTGCCCATGTCAAACTCGAAGCGGAGTTCGGAGGATGATGATGAAGAC
GAGTCGCGATCCAAGCGGCCCAAATCTCGAGATGCCGTTGACTGCGGTCCTGATATGGTCGATCTGCTGCCTGTT
CGGAGTTCGCCTCCTCCGGATACTATGGACAGCATCAGCAGCCGTATCTTGTCCAAGAAGTCGTCGCCTTCTATT
CTCACGTATTTCCAGAGCAGTCGCGCGACCATACCGTCTTCTTCTTCCAGAACCTCGGTCGCTTCTACCGTCATG
GAAGACGACTACCCCGTTAGCGGTGACTTGCTTCTCAGCTCGCAGGATTATCGAGACCTCCTCGATAAGATGGAT
AGGATTCCCAATTCCACGGGCGCGACGCCTCAGAGCTTCTCGTTCAAGTCCTCCGCCAGCACGCCGAGAATCGAG
TCTCTCGAACAGAAATTCAAGCGTCTGTGGCCCAAGGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTT
CTATGGGAGGTGACGCGCATCTTTCAGCACTGCCAAGTCGAGTCCGAAACCTGCAACCTGGCGTACGATGAAGGA
TGGGTCGACCAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGTCCTTTGCCGGCAAAGCTCTGCCTGTTGCC
AGCGACTCCAAGGCGTGGGCTCTGGCCTGCCGCGGCTTGTTGAACAAAACCCACCAAGTCTGCTTCTCGGCCGAG
CTCGTGATGCGGCCTGTTGCCAGAGGCTTGTTCCCGTTGGAGATGCGGCTGAACCCGCTGACGCTGGAGCCGAGT
CATCGACTTGCGCGACGGTTCGGGGCTGATCGCTGCCTCGAAGTCACCATTCCCGATCCGCTGTATCTGGAAAAG
GAGCTTCGCAAGGCCGCTGGTGGAGATTCCAGTTTTCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTC
CATCCGTTTGCCAGCCGGCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAAAGCCAAGGCCCGGCCATGTACAGG
ATTTACTTCTTTGCTTCGGACGGACACTACTTTCGCGAGTCCCCCGTCGGCGCCTTGCCTCCCCCGGGAGAGGCC
TCGGATCCCTTGTCGCGGACCAAGGTGAGGCCCGAGGGTCTCCTGGACTGGGCCATCGCCATCAAGAGGCCGGAG
AACTTGGCCATGTCGGCAGTCAAGCTCTTTTCGCGGCTATCCATCAGCCATACTCGGACCTTTTGTAACGTAGAG
TTGTCGCGAGAACAGATTCGGTTTCTGAAAAAGGACGTGGGCACGCACGAGGTCATGAACGACGGCCTGGGACGC
ATGTCCAAGGCGCTGGCCAGGAAGATTGCTGATAACCTCGGCTTGTCCGACACGCCATCTGGATATCAGGGACGG
ATAGGCAGCGCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGATCTCAACGATGGCGATATTTGGATCGAGCTG
TACCCGTCACAGATCAAGTGGCTTTGCGACTTTGACGACATCTCGCACCGCACCTTTGAGGTCAAGGACTACCCG
CGAGAGGCCAAGCCGGGAGCGGCACTGAACCAGCAGTTTCTACCGCTGCTCGAGGCCCAAGCTAGAGACCGGCTT
GCTATGAGACGCCATCTCGAGCAGACGCTCAGGACCAATCTCGTGGCTGACCTCGACGCGTTGGACGGAGCCCTA
GACGGTCCGTACGATCTACGACTGTGGCTTCGTCAGGTCGGTCCGACATCGAGCTCATATGGGGGTCCGTCATTC
CTGGCCGGGCTCCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTTCAGCCCAGACGGCAG
CAGTACATGTACGACCAGTGCCTCCACATCGCGACACGCAAGGCAGAGACGCTCCGGAAGAGCAAGTTGCACGTC
TCTGTCGCCCAGGCGACGTATCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTC
AACTTCTCGTCCAAGTTTGAGGCCGATGGCTTCTGTGACACGGCTCTCGACGGCCTGAATGTCCTGGTGGCGCGG
AACCCAGCCCATACCCTGTCGGATATGCAAAAGGTGATGACCGTCGCTCATCCGAAGCTGCGCAGGCTCAAGGAC
GTCATCGTCTTCTCAACCAAGGGCACCACGCCGCTGGCCGCCCTGCTCTCTGGCGGTGACTACGACGGCGACAAG
TGCTGGGTCTGCTGGGACCGTAACATCGTCGACAACTTCCAGGGCTGTCTGGCCGATGAGCAGGCGGAAACGCTA
AAGATGACCAAGCTGGAGATAACGGTCGACCAGCTCATCCCGGCGGTAGGACGAGAGAGGCATTGGAAGAGCTTG
TGTAATAAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTTCAGCCAGACATGCTGGGCAAATGCACCAAGTACAAG
GAGAGGCTCGACTACCTACGGGGAGTGACGGGGCCTCACATGTCCAAGCTGACGGCTCTGCTGAGCAACCTCGTC
GATCAGGCAAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAAGACGTTTTGCGAAGAGGAGCTCCAGCTGGGT
CTCTGGCTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACCACAGCCCGCTC
CTCGATGTCCTCAAGTTCAAGGTGGCCAAGCCAGCCATCGACGACTCGTTGGAGAAGCTCACTGGGGCCATGAGG
GCGCACAAAGATACGTTGCAGTACTACGACGCCGACCTTACTGCTCTCTACCGACGCTTCGATGCGAGACGAAGA
GAGTGCCCCGTCATCCACCAGCTACTGACGGACCTGCGCAACGACCTCGAAGTTGTGGCGGTCGAATGGGCAACG
AAGAGCCAGAGCAAAGACGAAAAGTTCATCACCAACTGCCAAGAGGTCTTTGCGTCGTGGTTGGCGGTCGAGCCG
AGGCCCGAGCTACAGGCTTCGGGGCAGTTGAAGCGGATCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGA
CTGCGCGTCATGAGTGAGTGGAATCGGCTCAAGGCGTCGGCGACTTGA
Transcript >Ophun1|672
ATGGCTTCGTCGGAGGGACTGAAGCGCATCATCAACAGTCTCAACGCCGATTACGGTCTCTCTATTCGGAGGATG
GATGTCACTCTCTCGCCGCGCAAGGCCAGGAATAGGATGCAGGCCTCGGCTGACGACGAGAACTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCAACGTCTGTACTATCACGACTTGAGTCAGCTGTCGGCAGCCATCGGCAGGTTCCGT
CAGCTGGCAGCCGATCTCCTCGGCTCGTCCGTCTCCTTCGCCGGCTCGGCTCAGCGGAGACGCCTTCTCATGAGC
CGTCTGCTCGATGTATTGGATGGAAAGGTGCCCATGTCAAACTCGAAGCGGAGTTCGGAGGATGATGATGAAGAC
GAGTCGCGATCCAAGCGGCCCAAATCTCGAGATGCCGTTGACTGCGGTCCTGATATGGTCGATCTGCTGCCTGTT
CGGAGTTCGCCTCCTCCGGATACTATGGACAGCATCAGCAGCCGTATCTTGTCCAAGAAGTCGTCGCCTTCTATT
CTCACGTATTTCCAGAGCAGTCGCGCGACCATACCGTCTTCTTCTTCCAGAACCTCGGTCGCTTCTACCGTCATG
GAAGACGACTACCCCGTTAGCGGTGACTTGCTTCTCAGCTCGCAGGATTATCGAGACCTCCTCGATAAGATGGAT
AGGATTCCCAATTCCACGGGCGCGACGCCTCAGAGCTTCTCGTTCAAGTCCTCCGCCAGCACGCCGAGAATCGAG
TCTCTCGAACAGAAATTCAAGCGTCTGTGGCCCAAGGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTT
CTATGGGAGGTGACGCGCATCTTTCAGCACTGCCAAGTCGAGTCCGAAACCTGCAACCTGGCGTACGATGAAGGA
TGGGTCGACCAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGTCCTTTGCCGGCAAAGCTCTGCCTGTTGCC
AGCGACTCCAAGGCGTGGGCTCTGGCCTGCCGCGGCTTGTTGAACAAAACCCACCAAGTCTGCTTCTCGGCCGAG
CTCGTGATGCGGCCTGTTGCCAGAGGCTTGTTCCCGTTGGAGATGCGGCTGAACCCGCTGACGCTGGAGCCGAGT
CATCGACTTGCGCGACGGTTCGGGGCTGATCGCTGCCTCGAAGTCACCATTCCCGATCCGCTGTATCTGGAAAAG
GAGCTTCGCAAGGCCGCTGGTGGAGATTCCAGTTTTCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTC
CATCCGTTTGCCAGCCGGCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAAAGCCAAGGCCCGGCCATGTACAGG
ATTTACTTCTTTGCTTCGGACGGACACTACTTTCGCGAGTCCCCCGTCGGCGCCTTGCCTCCCCCGGGAGAGGCC
TCGGATCCCTTGTCGCGGACCAAGGTGAGGCCCGAGGGTCTCCTGGACTGGGCCATCGCCATCAAGAGGCCGGAG
AACTTGGCCATGTCGGCAGTCAAGCTCTTTTCGCGGCTATCCATCAGCCATACTCGGACCTTTTGTAACGTAGAG
TTGTCGCGAGAACAGATTCGGTTTCTGAAAAAGGACGTGGGCACGCACGAGGTCATGAACGACGGCCTGGGACGC
ATGTCCAAGGCGCTGGCCAGGAAGATTGCTGATAACCTCGGCTTGTCCGACACGCCATCTGGATATCAGGGACGG
ATAGGCAGCGCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGATCTCAACGATGGCGATATTTGGATCGAGCTG
TACCCGTCACAGATCAAGTGGCTTTGCGACTTTGACGACATCTCGCACCGCACCTTTGAGGTCAAGGACTACCCG
CGAGAGGCCAAGCCGGGAGCGGCACTGAACCAGCAGTTTCTACCGCTGCTCGAGGCCCAAGCTAGAGACCGGCTT
GCTATGAGACGCCATCTCGAGCAGACGCTCAGGACCAATCTCGTGGCTGACCTCGACGCGTTGGACGGAGCCCTA
GACGGTCCGTACGATCTACGACTGTGGCTTCGTCAGGTCGGTCCGACATCGAGCTCATATGGGGGTCCGTCATTC
CTGGCCGGGCTCCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTTCAGCCCAGACGGCAG
CAGTACATGTACGACCAGTGCCTCCACATCGCGACACGCAAGGCAGAGACGCTCCGGAAGAGCAAGTTGCACGTC
TCTGTCGCCCAGGCGACGTATCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTC
AACTTCTCGTCCAAGTTTGAGGCCGATGGCTTCTGTGACACGGCTCTCGACGGCCTGAATGTCCTGGTGGCGCGG
AACCCAGCCCATACCCTGTCGGATATGCAAAAGGTGATGACCGTCGCTCATCCGAAGCTGCGCAGGCTCAAGGAC
GTCATCGTCTTCTCAACCAAGGGCACCACGCCGCTGGCCGCCCTGCTCTCTGGCGGTGACTACGACGGCGACAAG
TGCTGGGTCTGCTGGGACCGTAACATCGTCGACAACTTCCAGGGCTGTCTGGCCGATGAGCAGGCGGAAACGCTA
AAGATGACCAAGCTGGAGATAACGGTCGACCAGCTCATCCCGGCGGTAGGACGAGAGAGGCATTGGAAGAGCTTG
TGTAATAAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTTCAGCCAGACATGCTGGGCAAATGCACCAAGTACAAG
GAGAGGCTCGACTACCTACGGGGAGTGACGGGGCCTCACATGTCCAAGCTGACGGCTCTGCTGAGCAACCTCGTC
GATCAGGCAAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAAGACGTTTTGCGAAGAGGAGCTCCAGCTGGGT
CTCTGGCTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACCACAGCCCGCTC
CTCGATGTCCTCAAGTTCAAGGTGGCCAAGCCAGCCATCGACGACTCGTTGGAGAAGCTCACTGGGGCCATGAGG
GCGCACAAAGATACGTTGCAGTACTACGACGCCGACCTTACTGCTCTCTACCGACGCTTCGATGCGAGACGAAGA
GAGTGCCCCGTCATCCACCAGCTACTGACGGACCTGCGCAACGACCTCGAAGTTGTGGCGGTCGAATGGGCAACG
AAGAGCCAGAGCAAAGACGAAAAGTTCATCACCAACTGCCAAGAGGTCTTTGCGTCGTGGTTGGCGGTCGAGCCG
AGGCCCGAGCTACAGGCTTCGGGGCAGTTGAAGCGGATCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGA
CTGCGCGTCATGAGTGAGTGGAATCGGCTCAAGGCGTCGGCGACTTGA
Gene >Ophun1|672
ATGGCTTCGTCGGAGGGACTGAAGCGCATCATCAACAGTCTCAACGCCGATTACGGTCTCTCTATTCGGAGGATG
GATGTCACTCTCTCGCCGCGCAAGGCCAGGAATAGGATGCAGGCCTCGGCTGACGACGAGAACTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCAACGTCTGTACTATCACGACTTGAGTCAGCTGTCGGCAGCCATCGGCAGGTTCCGT
CAGCTGGCAGCCGATCTCCTCGGCTCGTCCGTCTCCTTCGCCGGCTCGGCTCAGCGGAGACGCCTTCTCATGAGC
CGTCTGCTCGATGTATTGGATGGAAAGGTGCCCATGTCAAACTCGAAGCGGAGTTCGGAGGATGATGATGAAGAC
GAGTCGCGATCCAAGCGGCCCAAATCTCGAGATGCCGTTGACTGCGGTCCTGATATGGTCGATCTGCTGCCTGTT
CGGAGTTCGCCTCCTCCGGATACTATGGACAGCATCAGCAGCCGTATCTTGTCCAAGAAGTCGTCGCCTTCTATT
CTCACGTATTTCCAGAGCAGTCGCGCGACCATACCGTCTTCTTCTTCCAGAACCTCGGTCGCTTCTACCGTCATG
GAAGACGACTACCCCGTTAGCGGTGACTTGCTTCTCAGCTCGCAGGATTATCGAGACCTCCTCGATAAGATGGAT
AGGATTCCCAATTCCACGGGCGCGACGCCTCAGAGCTTCTCGTTCAAGTCCTCCGCCAGCACGCCGAGAATCGAG
TCTCTCGAACAGAAATTCAAGCGTCTGTGGCCCAAGGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTT
CTATGGGAGGTGACGCGCATCTTTCAGCACTGCCAAGTCGAGTCCGAAACCTGCAACCTGGCGTACGATGAAGGA
TGGGTCGACCAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGTCCTTTGCCGGCAAAGCTCTGCCTGTTGCC
AGCGACTCCAAGGCGTGGGCTCTGGCCTGCCGCGGCTTGTTGAACAAAACCCACCAAGTCTGCTTCTCGGCCGAG
CTCGTGATGCGGCCTGTTGCCAGAGGCTTGTTCCCGTTGGAGATGCGGCTGAACCCGCTGACGCTGGAGCCGAGT
CATCGACTTGCGCGACGGTTCGGGGCTGATCGCTGCCTCGAAGTCACCATTCCCGATCCGCTGTATCTGGAAAAG
GAGCTTCGCAAGGCCGCTGGTGGAGATTCCAGTTTTCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTC
CATCCGTTTGCCAGCCGGCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAAAGCCAAGGCCCGGCCATGTACAGG
ATTTACTTCTTTGCTTCGGACGGACACTACTTTCGCGAGTCCCCCGTCGGCGCCTTGCCTCCCCCGGGAGAGGCC
TCGGATCCCTTGTCGCGGACCAAGGTGAGGCCCGAGGGTCTCCTGGACTGGGCCATCGCCATCAAGAGGCCGGAG
AACTTGGCCATGTCGGCAGTCAAGCTCTTTTCGCGGCTATCCATCAGCCATACTCGGACCTTTTGTAACGTAGAG
TTGTCGCGAGAACAGATTCGGTTTCTGAAAAAGGACGTGGGCACGCACGAGGTCATGAACGACGGCCTGGGACGC
ATGTCCAAGGCGCTGGCCAGGAAGATTGCTGATAACCTCGGCTTGTCCGACACGCCATCTGGATATCAGGGACGG
ATAGGCAGCGCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGATCTCAACGATGGCGATATTTGGATCGAGCTG
TACCCGTCACAGATCAAGTGGCTTTGCGACTTTGACGACATCTCGCACCGCACCTTTGAGGTCAAGGACTACCCG
CGAGAGGCCAAGCCGGGAGCGGCACTGAACCAGCAGTTTCTACCGCTGCTCGAGGCCCAAGCTAGAGACCGGCTT
GCTATGAGACGCCATCTCGAGCAGACGCTCAGGACCAATCTCGTGGCTGACCTCGACGCGTTGGACGGAGCCCTA
GACGGTCCGTACGATCTACGACTGTGGCTTCGTCAGGTCGGTCCGACATCGAGCTCATATGGGGGTCCGTCATTC
CTGGCCGGGCTCCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTTCAGCCCAGACGGCAG
CAGTACATGTACGACCAGTGCCTCCACATCGCGACACGCAAGGCAGAGACGCTCCGGAAGAGCAAGTTGCACGTC
TCTGTCGCCCAGGCGACGTATCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTC
AACTTCTCGTCCAAGTTTGAGGCCGATGGCTTCTGTGACACGGCTCTCGACGGCCTGAATGTCCTGGTGGCGCGG
AACCCAGCCCATACCCTGTCGGATATGCAAAAGGTGATGACCGTCGCTCATCCGAAGCTGCGCAGGCTCAAGGAC
GTCATCGTCTTCTCAACCAAGGGCACCACGCCGCTGGCCGCCCTGCTCTCTGGCGGTGACTACGACGGCGACAAG
TGCTGGGTCTGCTGGGACCGTAACATCGTCGACAACTTCCAGGGCTGTCTGGCCGATGAGCAGGCGGAAACGCTA
AAGATGACCAAGCTGGAGATAACGGTCGACCAGCTCATCCCGGCGGTAGGACGAGAGAGGCATTGGAAGAGCTTG
TGTAATAAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTTCAGCCAGACATGCTGGGCAAATGCACCAAGTACAAG
GAGAGGCTCGACTACCTACGGGGAGTGACGGGGCCTCACATGTCCAAGCTGACGGCTCTGCTGAGCAACCTCGTC
GATCAGGCAAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAAGACGTTTTGCGAAGAGGAGCTCCAGCTGGGT
CTCTGGCTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACCACAGCCCGCTC
CTCGATGTCCTCAAGTTCAAGGTGGCCAAGCCAGCCATCGACGACTCGTTGGAGAAGCTCACTGGGGCCATGAGG
GCGCACAAAGATACGTTGCAGTACTACGACGCCGACCTTACTGCTCTCTACCGACGCTTCGATGCGAGACGAAGA
GAGTGCCCCGTCATCCACCAGCTACTGACGGACCTGCGCAACGACCTCGAAGTTGTGGCGGTCGAATGGGCAACG
AAGAGCCAGAGCAAAGACGAAAAGTTCATCACCAACTGCCAAGAGGTCTTTGCGTCGTGGTTGGCGGTCGAGCCG
AGGCCCGAGCTACAGGCTTCGGGGCAGTTGAAGCGGATCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGA
CTGCGCGTCATGAGTGAGTGGAATCGGCTCAAGGCGTCGGCGACGTTTAAGACTTTTCACAACTCGAAGCCGACT
TTCGTGTGGCGGATGGCGGGCTCGTGGCTTTGTCAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail